From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan002485000
  • symbol?: sarA
  • description?: accessory regulator A

      descriptions from strain specific annotations:

    • accessory regulator A
    • accessory regulator A-like protein
    • accessory regulator A (SarA)
    • staphylococcal accessory regulator A
    • staphylococcal accessory regulator family
    • Staphylococcal accessory regulator A (SarA)
    • chain B, Crystal Structure Of Sara, A Transcription Regulator From Staphylococcus aureus subsp. aureus ECT-R 2
    • Transcriptional regulator sarA
  • strand?: -
  • coordinates?: 3002366..3002740
  • synteny block?: BlockID0017210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0672 (sarA)
    N315:
    SA0573 (sarA)
    NCTC8325:
    Newman:
    NWMN_0588 (sarA)
    USA300_FPR3757:
    04-02981:
    SA2981_0593 (sarA)
    08BA02176:
    C248_0700 (sarA)
    11819-97:
    MS7_0669 (sarA)
    71193:
    ST398NM01_0697
    ECT-R 2:
    ECTR2_569
    ED133:
    SAOV_0652c (sarA)
    ED98:
    SAAV_0580 (sarA)
    HO 5096 0412:
    SAEMRSA15_05440 (sarA)
    JH1:
    SaurJH1_0655
    JH9:
    SaurJH9_0640
    JKD6008:
    SAA6008_00634 (sarA)
    JKD6159:
    SAA6159_00573 (sarA)
    LGA251:
    SARLGA251_05520 (sarA)
    M013:
    M013TW_0605
    MRSA252:
    SAR0625 (sarA)
    MSHR1132:
    SAMSHR1132_05600
    MSSA476:
    SAS0584
    Mu3:
    SAHV_0614 (sarA)
    Mu50:
    SAV0616 (sarA)
    MW2:
    MW0580 (sarA)
    RF122:
    SAB0569c (sarA)
    ST398:
    SAPIG0697
    T0131:
    SAT0131_00684
    TCH60:
    HMPREF0772_12570 (sarA)
    TW20:
    SATW20_06930 (sarA)
    USA300_TCH1516:
    USA300HOU_0622 (sarA)
    VC40:
    SAVC_02725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHL
    N315            MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHL
    NCTC8325        MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHL
    Newman          MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHL
    USA300_FPR3757  MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHL
                    ************************************************************

    COL             NYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANN
    N315            NYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANN
    NCTC8325        NYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANN
    Newman          NYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANN
    USA300_FPR3757  NYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANN
                    ************************************************************

    COL             EIEL
    N315            EIEL
    NCTC8325        EIEL
    Newman          EIEL
    USA300_FPR3757  EIEL
                    ****