From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002491000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3005115..3005318
  • synteny block?: BlockID0017270
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0596
    08BA02176:
    C248_0703
    11819-97:
    MS7_0672
    71193:
    ST398NM01_0700
    ECT-R 2:
    ECTR2_572
    ED133:
    SAOV_0656c
    ED98:
    SAAV_0584
    HO 5096 0412:
    SAEMRSA15_05470
    JH1:
    SaurJH1_0658
    JH9:
    SaurJH9_0643
    JKD6008:
    SAA6008_00638
    JKD6159:
    SAA6159_00576
    LGA251:
    SARLGA251_05550
    M013:
    M013TW_0608
    MRSA252:
    SAR0628
    MSHR1132:
    SAMSHR1132_05640
    MSSA476:
    SAS0587
    Mu3:
    SAHV_0617
    Mu50:
    SAV0619
    MW2:
    MW0583
    RF122:
    ST398:
    SAPIG0700
    T0131:
    SAT0131_00688 (uhpT)
    TCH60:
    TW20:
    SATW20_06960
    USA300_TCH1516:
    USA300HOU_0641
    VC40:
    SAVC_02740

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKINHITIVLSFTKVDANGKQTEFKRRFANINPDASNDQIKTFSKLIERLTGETYSNIE
    N315            MSKINHITIVLSFTKVDANGKQTEFKRRFANINPDASNDQIKTFSKLIERLTGETYNNIE
    USA300_FPR3757  MSKINHITIVLSFTKVDANGKQTEFKRRFANINPDASNDQIKTFSKLIERLTGETYSNIE
                    ********************************************************.***

    COL             LIKSLSI
    N315            LIKSLSI
    USA300_FPR3757  LIKSLSI
                    *******