From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002507000
  • symbol?: mntC
  • description?: metal ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • metal ABC transporter substrate-binding protein
    • ABC transporter substrate-binding protein
    • periplasmic solute binding protein
    • ABC superfamily ATP binding cassette transporter, binding protein
    • ABC transporter ATP-binding protein
    • ABC transporter extracellular binding protein
    • iron ABC superfamily ATP binding cassette transporter, binding protein
    • iron-repressed lipoprotein
    • lipoprotein
    • Manganese ABC transporter, periplasmic-binding protein SitA
    • manganese ABC transporter substrate-binding lipoprotein (Adhesin B) (Saliva-binding protein)
    • Manganese ABC transporter substrate-binding protein SitA
    • Manganese-binding protein
  • strand?: -
  • coordinates?: 3020644..3021582
  • synteny block?: BlockID0017430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0607 (sitA)
    08BA02176:
    C248_0713
    11819-97:
    MS7_0682 (psaA)
    71193:
    ST398NM01_0710
    ECT-R 2:
    ECTR2_583
    ED133:
    SAOV_0666c
    ED98:
    SAAV_0594
    HO 5096 0412:
    SAEMRSA15_05570
    JH1:
    SaurJH1_0669
    JH9:
    SaurJH9_0654
    JKD6008:
    SAA6008_00648 (mntC)
    JKD6159:
    SAA6159_00586 (mntC)
    LGA251:
    SARLGA251_05650 (mntC)
    M013:
    M013TW_0619
    MRSA252:
    SAR0641
    MSHR1132:
    SAMSHR1132_05770
    MSSA476:
    SAS0597
    Mu3:
    SAHV_0628
    Mu50:
    SAV0631
    MW2:
    MW0593
    RF122:
    SAB0581c (mntC)
    ST398:
    SAPIG0710
    T0131:
    SAT0131_00699
    TCH60:
    HMPREF0772_12556 (sitC)
    TW20:
    SATW20_07060 (mntC)
    USA300_TCH1516:
    USA300HOU_0651
    VC40:
    SAVC_02790

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIV
    N315            MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIV
    NCTC8325        MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIV
    Newman          MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIV
    USA300_FPR3757  MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIV
                    ************************************************************

    COL             PVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSK
    N315            PVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSK
    NCTC8325        PVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSK
    Newman          PVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSK
    USA300_FPR3757  PVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSK
                    ************************************************************

    COL             DVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQ
    N315            DVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQ
    NCTC8325        DVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQ
    Newman          DVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQ
    USA300_FPR3757  DVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQ
                    ************************************************************

    COL             LEKLNN---DSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQM
    N315            LEKLNN---DSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQM
    NCTC8325        LEKLNNDSKDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQM
    Newman          LEKLNN---DSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQM
    USA300_FPR3757  LEKLNN---DSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQM
                    ******   ***************************************************

    COL             RQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMM
    N315            RQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMM
    NCTC8325        RQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMM
    Newman          RQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMM
    USA300_FPR3757  RQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMM
                    ************************************************************

    COL             KSNIETVHGSMK
    N315            KSNIETVHGSMK
    NCTC8325        KSNIETVHGSMK
    Newman          KSNIETVHGSMK
    USA300_FPR3757  KSNIETVHGSMK
                    ************