From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002512000
  • symbol?: tagA
  • description?: teichoic acid biosynthesis protein

      descriptions from strain specific annotations:

    • teichoic acid biosynthesis protein
    • N-acetylmannosaminyltransferase
    • putative N-acetylmannosaminyltransferase
    • N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase
    • UDP-N-acetyl-D-mannosamine transferase
    • WecB/TagA/CpsF family glycosyl transferase
  • strand?: +
  • coordinates?: 3025029..3025779
  • synteny block?: BlockID0017480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0693 (tagA)
    N315:
    SA0592 (tagA)
    NCTC8325:
    Newman:
    NWMN_0606 (tagA)
    USA300_FPR3757:
    04-02981:
    SA2981_0612 (tagA)
    08BA02176:
    C248_0718 (tagA)
    11819-97:
    MS7_0687 (tagA)
    71193:
    ST398NM01_0715
    ECT-R 2:
    ECTR2_588
    ED133:
    SAOV_0671 (tagA)
    ED98:
    SAAV_0599 (tagA)
    HO 5096 0412:
    SAEMRSA15_05620 (tagA)
    JH1:
    SaurJH1_0674
    JH9:
    SaurJH9_0659
    JKD6008:
    SAA6008_00653 (wecG)
    JKD6159:
    SAA6159_00591 (wecG)
    LGA251:
    SARLGA251_05700 (tagA)
    M013:
    M013TW_0624
    MRSA252:
    SAR0646 (tagA)
    MSHR1132:
    SAMSHR1132_05820
    MSSA476:
    SAS0602
    Mu3:
    SAHV_0633 (tagA)
    Mu50:
    SAV0636 (tagA)
    MW2:
    MW0598 (tagA)
    RF122:
    SAB0586 (tagA)
    ST398:
    SAPIG0715
    T0131:
    SAT0131_00705 (gatC)
    TCH60:
    HMPREF0772_12551 (tagA)
    TW20:
    SATW20_07110 (tagA)
    USA300_TCH1516:
    USA300HOU_0656 (tagA)
    VC40:
    SAVC_02815

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVEERSNTAKVDILGVDFDNTTMLQMVENIKTFFANQSTNNLFIVTANPEIVNYATTHQ
    N315            MTVEERSNTAKVDILGVDFDNTTMLQMVENIKTFFANQSTNNLFIVTANPEIVNYATTHQ
    NCTC8325        MTVEERSNTAKVDILGVDFDNTTMLQMVENIKTFFANQSTNNLFIVTANPEIVNYATTHQ
    Newman          MTVEERSNTAKVDILGVDFDNTTMLQMVENIKTFFANQSTNNLFIVTANPEIVNYATTHQ
    USA300_FPR3757  MTVEERSNTAKVDILGVDFDNTTMLQMVENIKTFFANQSTNNLFIVTANPEIVNYATTHQ
                    ************************************************************

    COL             AYLELINQASYIVADGTGVVKASHRLKQPLAHRIPGIELMDECLKIAHVNHQKVFLLGAT
    N315            AYLELINQASYIVADGTGVVKASHRLKQPLAHRIPGIELMDECLKIAHVNHQKVFLLGAT
    NCTC8325        AYLELINQASYIVADGTGVVKASHRLKQPLAHRIPGIELMDECLKIAHVNHQKVFLLGAT
    Newman          AYLELINQASYIVADGTGVVKASHRLKQPLAHRIPGIELMDECLKIAHVNHQKVFLLGAT
    USA300_FPR3757  AYLELINQASYIVADGTGVVKASHRLKQPLAHRIPGIELMDECLKIAHVNHQKVFLLGAT
                    ************************************************************

    COL             NEVVEAAQYALQQRYPNISFAHHHGYIDLEDETVVKRIKLFKPDYIFVGMGFPKQEEWIM
    N315            NEVVEAAQYALQQRYPNISFAHHHGYIDLEDETVVKRIKLFKPDYIFVGMGFPKQEEWIM
    NCTC8325        NEVVEAAQYALQQRYPNISFAHHHGYIDLEDETVVKRIKLFKPDYIFVGMGFPKQEEWIM
    Newman          NEVVEAAQYALQQRYPNISFAHHHGYIDLEDETVVKRIKLFKPDYIFVGMGFPKQEEWIM
    USA300_FPR3757  NEVVEAAQYALQQRYPNISFAHHHGYIDLEDETVVKRIKLFKPDYIFVGMGFPKQEEWIM
                    ************************************************************

    COL             THENQFESTVMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRALIDWKRIGRLKSIPIFM
    N315            THENQFESTVMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRALIDWKRIGRLKSIPIFM
    NCTC8325        THENQFESTVMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRALIDWKRIGRLKSIPIFM
    Newman          THENQFESTVMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRALIDWKRIGRLKSIPIFM
    USA300_FPR3757  THENQFESTVMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRALIDWKRIGRLKSIPIFM
                    ************************************************************

    COL             YKIAKAKRKIKKAK
    N315            YKIAKAKRKIKKAK
    NCTC8325        YKIAKAKRKIKKAK
    Newman          YKIAKAKRKIKKAK
    USA300_FPR3757  YKIAKAKRKIKKAK
                    **************