From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002517000
  • symbol?: tagX
  • description?: glycosyl transferase

      descriptions from strain specific annotations:

    • glycosyl transferase
    • teichoic acid biosynthesis protein X
    • glycosyltransferase TagX
    • putative glycosyl transferase
    • Putative glycosyltransferase tagX
    • glycosyl transferase family 2 family protein
    • glycosyl transferase family protein
    • Tagx
    • tagX protein
    • teichoic acid biosynthesis enzyme
  • strand?: +
  • coordinates?: 3029011..3030100
  • synteny block?: BlockID0017530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0697 (tagX)
    N315:
    SA0596 (tagX)
    NCTC8325:
    Newman:
    NWMN_0610 (tagX)
    USA300_FPR3757:
    04-02981:
    SA2981_0616 (tagX)
    08BA02176:
    C248_0722
    11819-97:
    MS7_0691 (tagX)
    71193:
    ST398NM01_0719
    ECT-R 2:
    ECTR2_592
    ED133:
    SAOV_0675 (tagX)
    ED98:
    SAAV_0603 (tagX)
    HO 5096 0412:
    SAEMRSA15_05660
    JH1:
    SaurJH1_0678
    JH9:
    SaurJH9_0663
    JKD6008:
    SAA6008_00657 (tagX)
    JKD6159:
    SAA6159_00595 (tagX)
    LGA251:
    SARLGA251_05740
    M013:
    M013TW_0628
    MRSA252:
    SAR0650
    MSHR1132:
    SAMSHR1132_05860
    MSSA476:
    SAS0606
    Mu3:
    SAHV_0637 (tagX)
    Mu50:
    SAV0640 (tagX)
    MW2:
    MW0602 (tagX)
    RF122:
    SAB0590
    ST398:
    SAPIG0719
    T0131:
    SAT0131_00709 (lig)
    TCH60:
    HMPREF0772_12547 (tagX)
    TW20:
    SATW20_07150
    USA300_TCH1516:
    USA300HOU_0660 (tagX)
    VC40:
    SAVC_02835

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRFTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERLQRELKHISLIQ
    N315            ------------------MLISIESKEHYRILCIDGGSTDQTIPMIERLQRELKHISLIQ
    NCTC8325        MRFTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERLQRELKHISLIQ
    Newman          MRFTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERLQRELKHISLIQ
    USA300_FPR3757  MRFTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPMIERLQRELKHISLIQ
                                      :*****************************************

    COL             LQNASIATCINKGLMDIKMTDPHDSDAFMVIKPTSIVLPGKLDRLTAAFKNNDNIDMVIG
    N315            LQNASIATCINKGLMDIKMTDPHDSDAFMVINPTSIVLPGKLDRLTAAFKNNDNIDMVIG
    NCTC8325        LQNASIATCINKGLMDIKMTDPHDSDAFMVIKPTSIVLPGKLDRLTAAFKNNDNIDMVIG
    Newman          LQNASIATCINKGLMDIKMTDPHDSDAFMVIKPTSIVLPGKLDRLTAAFKNNDNIDMVIG
    USA300_FPR3757  LQNASIATCINKGLMDIKMTDPHDSDAFMVIKPTSIVLPGKLDRLTAAFKNNDNIDMVIG
                    *******************************:****************************

    COL             QRAYNYHGEWKLKSADEFIKDNRIVTLTEQPDLLSMMSFDGKLFSAKFAELQCDETLANT
    N315            QRAYNYHGEWKLKSADEFIKDNRIVTLTEQPDLLSMMSFDGKLFSAKFAELQCDETLANT
    NCTC8325        QRAYNYHGEWKLKSADEFIKDNRIVTLTEQPDLLSMMSFDGKLFSAKFAELQCDETLANT
    Newman          QRAYNYHGEWKLKSADEFIKDNRIVTLTEQPDLLSMMSFDGKLFSAKFAELQCDETLANT
    USA300_FPR3757  QRAYNYHGEWKLKSADEFIKDNRIVTLTEQPDLLSMMSFDGKLFSAKFAELQCDETLANT
                    ************************************************************

    COL             YNHAILVKAMQKATDIHLVSQMIVGDNDIDTHATSNDEDFNRYITEIMKIRQRVMEMLLL
    N315            YNHAILVKAMQKATDIHLVSQMIVGDNDIDTHATSNDEDFNRYIIEIMKIRQRVMEMLLL
    NCTC8325        YNHAILVKAMQKATDIHLVSQMIVGDNDIDTHATSNDEDFNRYITEIMKIRQRVMEMLLL
    Newman          YNHAILVKAMQKATDIHLVSQMIVGDNDIDTHATSNDEDFNRYITEIMKIRQRVMEMLLL
    USA300_FPR3757  YNHAILVKAMQKATDIHLVSQMIVGDNDIDTHATSNEEDFNRYITEIMKIRQRVMEMLLL
                    ************************************:******* ***************

    COL             PEQRLLYSDMVDRILFNNSLKYYMNEHPAVTHTTIQLVKDYIMSMQHSDYVSQNMFDIIN
    N315            PEQRLLYSDMVDRILFNNSLKYYMNEHPAVTHTTIQLVKDYIMSMQHSDYVSQNMFDIIN
    NCTC8325        PEQRLLYSDMVDRILFNNSLKYYMNEHPAVTHTTIQLVKDYIMSMQHSDYVSQNMFDIIN
    Newman          PEQRLLYSDMVDRILFNNSLKYYMNEHPAVTHTTIQLVKDYIMSMQHSDYVSQNMFDIIN
    USA300_FPR3757  PEQRLLYSDMVDRILFNNSLKYYMNEHPAVTHTTIQLVKDYIMSMQHSDYVSQNMFDIIN
                    ************************************************************

    COL             TVEFIGENWDREIYELWRQTLIQVGINRPTYKKFLIQLKGRKFAHRTKSMLKR
    N315            TVEFIGENWDREIYELWRQTLIQVGINRPTYKKFLIQLKGRKFAHRTKSMLKR
    NCTC8325        TVEFIGENWDREIYELWRQTLIQVGINRPTYKKFLIQLKGRKFAHRTKSMLKR
    Newman          TVEFIGENWDREIYELWRQTLIQVGINRPTYKKFLIQLKGRKFAHRTKSMLKR
    USA300_FPR3757  TVEFIGENWDREIYELWRQTLIQVGINRPTYKKFLIQLKGRKFAHRTKSMLKR
                    *****************************************************