From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002541000
  • symbol?: vraG
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • bacitracin ABC transporter permease
    • ABC-type transport system permease component VraG
    • Bacitracin export permease protein BceB
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter, permease protein
    • ABC transporter ATP-binding protein
    • ftsX-like permease family protein
    • putative ABC transporter permease
    • putative permease
  • strand?: +
  • coordinates?: 3051739..3053640
  • synteny block?: BlockID0017770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0617 (vraG)
    NCTC8325:
    Newman:
    NWMN_0631 (vraG)
    USA300_FPR3757:
    04-02981:
    SA2981_0638 (vraG)
    08BA02176:
    C248_0746
    11819-97:
    MS7_0712
    71193:
    ST398NM01_0740
    ECT-R 2:
    ECTR2_613
    ED133:
    SAOV_0696
    ED98:
    SAAV_0624
    HO 5096 0412:
    SAEMRSA15_05880
    JH1:
    SaurJH1_0700
    JH9:
    SaurJH9_0685
    JKD6008:
    SAA6008_00678
    JKD6159:
    SAA6159_00616
    LGA251:
    SARLGA251_05950 (vraG)
    M013:
    M013TW_0649
    MRSA252:
    SAR0672
    MSHR1132:
    SAMSHR1132_06080
    MSSA476:
    SAS0627
    Mu3:
    SAHV_0659 (vraG)
    Mu50:
    SAV0662 (vraG)
    MW2:
    MW0624 (vraG)
    RF122:
    SAB0611
    ST398:
    SAPIG0740
    T0131:
    SAT0131_00732
    TCH60:
    HMPREF0772_12526 (vraG)
    TW20:
    SATW20_07370 (vraG)
    USA300_TCH1516:
    USA300HOU_0683 (vraE)
    VC40:
    SAVC_02940

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MTFNEIIFKNFRQNLSHYAIYLFSLITSVVLYFSFVALKYAHKLNMTESYPIIKEG
    N315            MALIMTFNEIIFKNFRQNLSHYAIYLFSLITSVVLYFSFVALKYAHKLNMTESYPIIKEG
    NCTC8325        ----MTFNEIIFKNFRQNLSHYAIYLFSLITSVVLYFSFVALKYAHKLNMTESYPIIKEG
    Newman          MALIMTFNEIIFKNFRQNLSHYAIYLFSLITSVVLYFSFVALKYAHKLNMTESYPIIKEG
    USA300_FPR3757  ----MTFNEIIFKNFRQNLSHYAIYLFSLITSVVLYFSFVALKYAHKLNMTESYPIIKEG
                        ********************************************************

    COL             SQVGSYFLFFIIIAFLLYANVLFIKRRSYELALYQTLGLSKFNIIYILMLEQLLIFIITA
    N315            SQVGSYFLFFIIIAFLLYANVLFIKRRSYELALYQTLGLSKFNIIYILMLEQLLIFIITA
    NCTC8325        SQVGSYFLFFIIIAFLLYANVLFIKRRSYELALYQTLGLSKFNIIYILMLEQLLIFIITA
    Newman          SQVGSYFLFFIIIAFLLYANVLFIKRRSYELALYQTLGLSKFNIIYILMLEQLLIFIITA
    USA300_FPR3757  SQVGSYFLFFIIIAFLLYANVLFIKRRSYELALYQTLGLSKFNIIYILMLEQLLIFIITA
                    ************************************************************

    COL             ILGIIIGIFGSKLLLMIVFTLLGIKEKVPIIFSLRAVFETLMLIGVAYFLTSAQNFILVF
    N315            ILGIIIGIFGSKLLLMIVFTLLGIKEKVPIIFSLRAVFETLMLIGVAYFLTSAQNFILVF
    NCTC8325        ILGIIIGIFGSKLLLMIVFTLLGIKEKVPIIFSLRAVFETLMLIGVAYFLTSAQNFILVF
    Newman          ILGIIIGIFGSKLLLMIVFTLLGIKEKVPIIFSLRAVFETLMLIGVAYFLTSAQNFILVF
    USA300_FPR3757  ILGIIIGIFGSKLLLMIVFTLLGIKEKVPIIFSLRAVFETLMLIGVAYFLTSAQNFILVF
                    ************************************************************

    COL             KQSISQMSKNNQVKETNHNKITFEEVVLGILGIVLITTGYYLSLNIVQYYDSIGTLMFIL
    N315            KQSISQMSKNNQVKETNHNKITFEEVVLGILGIVLITTGYYLSLNIVQYYDSIGILMFIL
    NCTC8325        KQSISQMSKNNQVKETNHNKITFEEVVLGILGIVLITTGYYLSLNIVQYYDSIGTLMFIL
    Newman          KQSISQMSKNNQVKETNHNKITFEEVVLGILGIVLITTGYYLSLNIVQYYDSIGTLMFIL
    USA300_FPR3757  KQSISQMSKNNQVKETNHNKITFEEVVLGILGIVLITTGYYLSLNIVQYYDSIGTLMFIL
                    ****************************************************** *****

    COL             LSTVIGAYLFFKSSVSLVFKMVKKFRKGVISVNDVMFSSSIMYRIKKNAFSLTVMAIISA
    N315            LSTVIGAYLFFKSSVSLVFKMVKKFRKGVISVNDVMFSSSIMYRIKKNAFSLTVMAIISA
    NCTC8325        LSTVIGAYLFFKSSVSLVFKMVKKFRKGVISVNDVMFSSSIMYRIKKNAFSLTVMAIISA
    Newman          LSTVIGAYLFFKSSVSLVFKMVKKFRKGVISVNDVMFSSSIMYRIKKNAFSLTVMAIISA
    USA300_FPR3757  LSTVIGAYLFFKSSVSLVFKMVKKFRKGVISVNDVMFSSSIMYRIKKNAFSLTVMAIISA
                    ************************************************************

    COL             ITVSVLCFAAISRASLSSEIKYTAPHDVTIKDQQKANQLASELNNQKIPHFYNYKEVIHT
    N315            ITVSVLCFAAISRASLSSEIKYTAPHDVTIKDQQKANQLASELNNQKIPHFYNYKEVIHT
    NCTC8325        ITVSVLCFAAISRASLSSEIKYTAPHDVTIKDQQKANQLASELNNQKIPHFYNYKEVIHT
    Newman          ITVSVLCFAAISRASLSSEIKYTAPHDVTIKDQQKANQLASELNNQKIPHFYNYKEVIHT
    USA300_FPR3757  ITVSVLCFAAISRASLSSEIKYTAPHDVTIKDQQKANQLASELNNQKIPHFYNYKEVIHT
                    ************************************************************

    COL             KLYKDNLFDVKAKEPYNVTITSDKYIPNTDLKRGQADLFVAEGSIKDLVKHKKHGKAIIG
    N315            KLYKDNLFDVKAKEPYNVTITSDKYIPNTDLKRGQADLFVAEGSIKDLVKHKKHGKAIIG
    NCTC8325        KLYKDNLFDVKAKEPYNVTITSDKYIPNTDLKRGQADLFVAEGSIKDLVKHKKHGKAIIG
    Newman          KLYKDNLFDVKAKEPYNVTITSDKYIPNTDLKRGQADLFVAEGSIKDLVKHKKHGKAIIG
    USA300_FPR3757  KLYKDNLFDVKAKEPYNVTITSDKYIPNTDLKRGQADLFVAEGSIKDLVKHKKHGKAIIG
                    ************************************************************

    COL             TKKHHVNIKLRKDINKIYFMTDVDLGGPTFVLNDKDYQEIRKYTKAKHIVSQFGFDLKHK
    N315            TKKHHVNIKLRKDINKIYFMTDVDLGGPTFVLNDKDYQEIRKYTKAKHIVSQFGFDLKHK
    NCTC8325        TKKHHVNIKLRKDINKIYFMTDVDLGGPTFVLNDKDYQEIRKYTKAKHIVSQFGFDLKHK
    Newman          TKKHHVNIKLRKDINKIYFMTDVDLGGPTFVLNDKDYQEIRKYTKAKHIVSQFGFDLKHK
    USA300_FPR3757  TKKHHVNIKLRKDINKIYFMTDVDLGGPTFVLNDKDYQEIRKYTKAKHIVSQFGFDLKHK
                    ************************************************************

    COL             KDALALEKAKNKVDKSIETRSEAISSISSLTGILLFVTSFLGITFLIAVCCIIYIKQIDE
    N315            KDALALEKVKNKVDKSIKTRSEAISSISSLTGILLFVTSFLGITFLIAVCCIIYIKQIDE
    NCTC8325        KDALALEKAKNKVDKSIETRSEAISSISSLTGILLFVTSFLGITFLIAVCCIIYIKQIDE
    Newman          KDALALEKAKNKVDKSIETRSEAISSISSLTGILLFVTSFLGITFLIAVCCIIYIKQIDE
    USA300_FPR3757  KDALALEKAKNKVDKSIETRSEAISSISSLTGILLFVTSFLGITFLIAVCCIIYIKQIDE
                    ********.********:******************************************

    COL             TEDELENYSILRKLGFTQKDMARGLKFKIMFNFGLPLVIALSHAYFTSLAYMKLMGTTNQ
    N315            TEDELENYSILRKLGFTQKDMARGLKFKIMFNFGLPLVIALSHAYFTSLAYMKLMGTTNQ
    NCTC8325        TEDELENYSILRKLGFTQKDMARGLKFKIMFNFGLPLVIALSHAYFTSLAYMKLMGTTNQ
    Newman          TEDELENYSILRKLGFTQKDMARGLKFKIMFNFGLPLVIALSHAYFTSLAYMKLMGTTNQ
    USA300_FPR3757  TEDELENYSILRKLGFTQKDMARGLKFKIMFNFGLPLVIALSHAYFTSLAYMKLMGTTNQ
                    ************************************************************

    COL             IPVFIVMGLYICMYAVFAVTAYNHSKRTIRHSI
    N315            IPVFIVMGLYICMYAVFAVTAYNHSKRTIRHSI
    NCTC8325        IPVFIVMGLYICMYAVFAVTAYNHSKRTIRHSI
    Newman          IPVFIVMGLYICMYAVFAVTAYNHSKRTIRHSI
    USA300_FPR3757  IPVFIVMGLYICMYAVFAVTAYNHSKRTIRHSI
                    *********************************