From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002561000
  • symbol?:
  • description?: ZK354.3 domain protein

      descriptions from strain specific annotations:

    • ZK354.3 domain protein
    • putative lipoprotein
    • lipoprotein, putative
  • strand?: +
  • coordinates?: 3074060..3074461
  • synteny block?: BlockID0017970
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0654
    08BA02176:
    C248_0762
    11819-97:
    MS7_0729
    71193:
    ST398NM01_0755
    ECT-R 2:
    ECTR2_629
    ED133:
    SAOV_0712
    ED98:
    SAAV_0640
    HO 5096 0412:
    SAEMRSA15_06030
    JH1:
    SaurJH1_0717
    JH9:
    SaurJH9_0701
    JKD6008:
    SAA6008_00694
    JKD6159:
    SAA6159_00632
    LGA251:
    SARLGA251_06100
    M013:
    M013TW_0664
    MRSA252:
    SAR0730
    MSHR1132:
    SAMSHR1132_06230
    MSSA476:
    SAS0642
    Mu3:
    SAHV_0674
    Mu50:
    SAV0677
    MW2:
    MW0639
    RF122:
    SAB0626
    ST398:
    SAPIG0755
    T0131:
    SAT0131_00748
    TCH60:
    HMPREF0772_12510
    TW20:
    SATW20_07520
    USA300_TCH1516:
    USA300HOU_0700
    VC40:
    SAVC_03015

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQK
    N315            MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQK
    NCTC8325        MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQK
    Newman          MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQK
    USA300_FPR3757  MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQK
                    ************************************************************

    COL             DLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSAD
    N315            DLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSTD
    NCTC8325        DLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSAD
    Newman          DLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSAD
    USA300_FPR3757  DLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSAD
                    **********************************************************:*

    COL             KDQKANDKHQS
    N315            KDQKANDKHQS
    NCTC8325        KDQKANDKHQS
    Newman          KDQKANDKHQS
    USA300_FPR3757  KDQKANDKHQS
                    ***********