From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002796000
  • symbol?: emp
  • description?: extracellular ECM and plasma binding protein

      descriptions from strain specific annotations:

    • extracellular ECM and plasma binding protein
    • secretory extracellular matrix and plasma binding protein
    • Extracellular ECM and plasma binding protein Emp
    • extracellular matrix protein-binding protein emp
    • extracellular matrix -binding protein emp
    • extracellular matrix and plasma binding protein precursor
    • Extracellular ECM and plasma binding protein mp
    • extracellular matrix protein-binding protein emp (40 kDavitronectin-binding cell surface protein)
    • Fibrinogen-binding protein
  • strand?: +
  • coordinates?: 3262929..3263957
  • synteny block?: BlockID0019890
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0858 (empbp)
    N315:
    SA0744 (ssp)
    NCTC8325:
    Newman:
    NWMN_0758 (ssp)
    USA300_FPR3757:
    SAUSA300_0774 (empbp)
    04-02981:
    SA2981_0768 (ssp)
    08BA02176:
    C248_0882
    11819-97:
    MS7_0841 (emp)
    71193:
    ST398NM01_0869
    ECT-R 2:
    ECTR2_741
    ED133:
    SAOV_0830
    ED98:
    SAAV_0759 (empbp)
    HO 5096 0412:
    SAEMRSA15_07160
    JH1:
    SaurJH1_0830
    JH9:
    SaurJH9_0814
    JKD6008:
    SAA6008_00805 (ssp)
    JKD6159:
    SAA6159_00745 (ssp)
    LGA251:
    SARLGA251_07210
    M013:
    M013TW_0780
    MRSA252:
    SAR0845
    MSHR1132:
    MSSA476:
    SAS0754
    Mu3:
    SAHV_0809 (ssp)
    Mu50:
    SAV0813 (ssp)
    MW2:
    MW0767 (ssp)
    RF122:
    SAB0746
    ST398:
    SAPIG0869
    T0131:
    SAT0131_00890
    TCH60:
    HMPREF0772_12389 (empbp)
    TW20:
    SATW20_08640
    USA300_TCH1516:
    USA300HOU_0821 (emp)
    VC40:
    SAVC_03595

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKKLLVLTMSTLFATQIMNSNHAKASVTESVDKKFVVPESGINKIIPAYDEFKNSPKVN
    N315            MKKKLLVLTMSTLFATQLINSNHAKASVTESVDKKFVVPESGINKIIPAYDEFKNSPKVN
    NCTC8325        MKKKLLVLTMSTLFATQIMNSNHAKASVTESVDKKFVVPESGINKIIPAYDEFKNSPKVN
    Newman          MKKKLLVLTMSTLFATQIMNSNHAKASVTESVDKKFVVPESGINKIIPAYDEFKNSPKVN
    USA300_FPR3757  MKKKLLVLTMSTLFATQIMNSNHAKASVTESVDKKFVVPESGINKIIPAYDEFKNSPKVN
                    *****************::*****************************************

    COL             VSNLTDNKNFVASEDKLNKIADSSAASKIVDKNFVVPESKLGNIVPEYKEINNRVNVATN
    N315            VSNLTDNKNFVVSEDKLNKIVDSSAASKIVDKNFAVPESKLGNIVPEYKEINNRVNVATN
    NCTC8325        VSNLTDNKNFVASEDKLNKIADSSAASKIVDKNFVVPESKLGNIVPEYKEINNRVNVATN
    Newman          VSNLTDNKNFVASEDKLNKIADSSAASKIVDKNFVVPESKLGNIVPEYKEINNRVNVATN
    USA300_FPR3757  VSNLTDNKNFVASEDKLNKIADSSAASKIVDKNFVVPESKLGNIVPEYKEINNRVNVATN
                    ***********.********.*************.*************************

    COL             NPASQQVDKHFVAKGPEVNRFITQNKVNHHFITTQTHYKKVITSYKSTHVHKHVNHAKDS
    N315            NPASQQVDKHFVAKGPEVNRFITQNKVNHHFITTQTHYKKVITSYKSTHVHKHVNHAKDS
    NCTC8325        NPASQQVDKHFVAKGPEVNRFITQNKVNHHFITTQTHYKKVITSYKSTHVHKHVNHAKDS
    Newman          NPASQQVDKHFVAKGPEVNRFITQNKVNHHFITTQTHYKKVITSYKSTHVHKHVNHAKDS
    USA300_FPR3757  NPASQQVDKHFVAKGPEVNRFITQNKVNHHFITTQTHYKKVITSYKSTHVHKHVNHAKDS
                    ************************************************************

    COL             INKHFIVKPSESPRYTHPSQSLIIKHHFAVPGYHAHKFVTPGHASIKINHFCVVPQINSF
    N315            INKHFIVKPSESPRYTHPSQSLIIKHHFAVPGYHAHKFVTPGHASIKINHFCVVPQINSF
    NCTC8325        INKHFIVKPSESPRYTHPSQSLIIKHHFAVPGYHAHKFVTPGHASIKINHFCVVPQINSF
    Newman          INKHFIVKPSESPRYTHPSQSLIIKHHFAVPGYHAHKFVTPGHASIKINHFCVVPQINSF
    USA300_FPR3757  INKHFIVKPSESPRYTHPSQSLIIKHHFAVPGYHAHKFVTPGHASIKINHFCVVPQINSF
                    ************************************************************

    COL             KVIPPYGHNSHRMHVPSFQNNTTATHQNAKVNKAYDYKYFYSYKVVKGVKKYFSFSQSNG
    N315            KVIPPYGHNSHRMHVPSFQNNTTATHQNAKVNKAYDYKYFYSYKVVKGVKKYFSFSQSNG
    NCTC8325        KVIPPYGHNSHRMHVPSFQNNTTATHQNAKVNKAYDYKYFYSYKVVKGVKKYFSFSQSNG
    Newman          KVIPPYGHNSHRMHVPSFQNNTTATHQNAKVNKAYDYKYFYSYKVVKGVKKYFSFSQSNG
    USA300_FPR3757  KVIPPYGHNSHRMHVPSFQNNTTATHQNAKVNKAYDYKYFYSYKVVKGVKKYFSFSQSNG
                    ************************************************************

    COL             YKIGKPSLNIKNVNYQYAVPSYSPTHYVPEFKGSLPAPRV
    N315            YKIGKPSLNIKNVNYQYAVPSYSPTHYVPEFKGSLPAPRV
    NCTC8325        YKIGKPSLNIKNVNYQYAVPSYSPTHYVPEFKGSLPAPRV
    Newman          YKIGKPSLNIKNVNYQYAVPSYSPTHYVPEFKGSLPAPRV
    USA300_FPR3757  YKIGKPSLNIKNVNYQYAVPSYSPTHYVPEFKGSLPAPRV
                    ****************************************