From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002893000
  • symbol?:
  • description?: DUF368 domain-containing protein

      descriptions from strain specific annotations:

    • DUF368 domain-containing protein
    • integral membrane protein
    • Membrane protein
  • strand?: -
  • coordinates?: 3338267..3339118
  • synteny block?: BlockID0020590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0796
    08BA02176:
    C248_0910
    11819-97:
    MS7_0868
    71193:
    ST398NM01_0896
    ECT-R 2:
    ECTR2_768
    ED133:
    SAOV_0858c
    ED98:
    SAAV_0812
    HO 5096 0412:
    SAEMRSA15_07430
    JH1:
    SaurJH1_0858
    JH9:
    SaurJH9_0842
    JKD6008:
    SAA6008_00863
    JKD6159:
    SAA6159_00772
    LGA251:
    SARLGA251_07700
    M013:
    M013TW_0833
    MRSA252:
    SAR0875
    MSHR1132:
    SAMSHR1132_07650
    MSSA476:
    SAS0783
    Mu3:
    SAHV_0837
    Mu50:
    SAV0841
    MW2:
    MW0794
    RF122:
    SAB0773c
    ST398:
    SAPIG0896
    T0131:
    SAT0131_00940
    TCH60:
    HMPREF0772_12335
    TW20:
    SATW20_09130
    USA300_TCH1516:
    USA300HOU_0869
    VC40:
    SAVC_03740

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQQFKWINILKGFAMGTSDLVPGVSGGTIALLLGIYNQFIASISGIFSRRFWPSFTFLIP
    N315            MQQFKWINILKGFAMGTSDLVPGVSGGTIALLLGIYNQFIASISGIFSRRFWPSFTFLIP
    NCTC8325        MQQFKWINILKGFAMGTSDLVPGVSGGTIALLLGIYNQFIASISGIFSRRFWPSFTFLIP
    Newman          MQQFKWINILKGFAMGTSDLVPGVSGGTIALLLGIYNQFIASISGIFSRRFWPSFTFLIP
    USA300_FPR3757  MQQFKWINILKGFAMGTSDLVPGVSGGTIALLLGIYNQFIASISGIFSRRFWPSFTFLIP
                    ************************************************************

    COL             IIIGMLLAMGSLSNLFNYLLSQHHIPTMFFFGGLIIGIVPYLLKISNYKTSFTTKHYMMV
    N315            IIIGMLLAMGSLSNLFNYLLSQHHIPTMFFFGGLIIGIVPYLLKISNYKTSFTTKHYMMV
    NCTC8325        IIIGMLLAMGSLSNLFNYLLSQHHIPTMFFFGGLIIGIVPYLLKISNYKTSFTTKHYMMV
    Newman          IIIGMLLAMGSLSNLFNYLLSQHHIPTMFFFGGLIIGIVPYLLKISNYKTSFTTKHYMMV
    USA300_FPR3757  IIIGMLLAMGSLSNLFNYLLSQHHIPTMFFFGGLIIGIVPYLLKISNYKTSFTTKHYMMV
                    ************************************************************

    COL             IAGIAILIVITLMNNGDKHAGETLTLSTSLIIKYFIAGMCASSAMLLPGISGSFMLLVFG
    N315            IAGIAILIVITLMNNGDKHAGETLTLSTGLIIKYFIAGMCASSAMLLPGISGSFMLLVFG
    NCTC8325        IAGIAILIVITLMNNGDKHAGETLTLSTSLIIKYFIAGMCASSAMLLPGISGSFMLLVFG
    Newman          IAGIAILIVITLMNNGDKHAGETLTLSTSLIIKYFIAGMCASSAMLLPGISGSFMLLVFG
    USA300_FPR3757  IAGIAILIVITLMNNGDKHAGETLTLSTSLIIKYFIAGMCASSAMLLPGISGSFMLLVFG
                    ****************************.*******************************

    COL             VYGTVMLAISEVVKLNFAGLPILLAVGFGVLAGFIISSKIIQYFLTHHKLMTFALIIGFV
    N315            VYGTVMLAISEVVKLNFTGLPILLAVGFGVLAGFIISSKIIQYFLTHHKLMTFALIIGFV
    NCTC8325        VYGTVMLAISEVVKLNFAGLPILLAVGFGVLAGFIISSKIIQYFLTHHKLMTFALIIGFV
    Newman          VYGTVMLAISEVVKLNFAGLPILLAVGFGVLAGFIISSKIIQYFLTHHKLMTFALIIGFV
    USA300_FPR3757  VYGTVMLAISEVVKLNFAGLPILLAVGFGVLAGFIISSKIIQYFLTHHKLMTFALIIGFV
                    *****************:******************************************

    COL             VGSLFAVFPGLPTNIVMWFVSLVVFIIGFIVSLTLGRITAENE
    N315            VGSLFAVFPGLPTNIVMWFVSLVVFIIGFIVSLTLGRITAENE
    NCTC8325        VGSLFAVFPGLPTNIVMWFVSLVVFIIGFIVSLTLGRITAENE
    Newman          VGSLFAVFPGLPTNIVMWFVSLVVFIIGFIVSLTLGRITAENE
    USA300_FPR3757  VGSLFAVFPGLPTNIVMWFVSLVVFIIGFIVSLTLGRITAENE
                    *******************************************