From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003072000
  • symbol?:
  • description?: TVP38/TMEM64 family protein

      descriptions from strain specific annotations:

    • TVP38/TMEM64 family protein
    • alkaline phosphatase
    • probable membrane protein
  • strand?: +
  • coordinates?: 3459082..3459657
  • synteny block?: BlockID0021800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0918
    08BA02176:
    C248_0964
    11819-97:
    MS7_0918
    71193:
    ST398NM01_0946
    ECT-R 2:
    ECTR2_819
    ED133:
    SAOV_0910
    ED98:
    SAAV_0924
    HO 5096 0412:
    SAEMRSA15_07930
    JH1:
    SaurJH1_0982
    JH9:
    SaurJH9_0963
    JKD6008:
    SAA6008_00916
    JKD6159:
    SAA6159_00822
    LGA251:
    SARLGA251_08810
    M013:
    M013TW_0882
    MRSA252:
    SAR0925
    MSHR1132:
    SAMSHR1132_08150
    MSSA476:
    SAS0833
    Mu3:
    SAHV_0958
    Mu50:
    SAV0963
    MW2:
    MW0845
    RF122:
    SAB0832
    ST398:
    SAPIG0946
    T0131:
    SAT0131_00996 (thiD)
    TCH60:
    HMPREF0772_12283
    TW20:
    SATW20_09630
    USA300_TCH1516:
    USA300HOU_0922
    VC40:
    SAVC_03990

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSFHQVEEWFEIFRQFGYLPGFILLYIRAIIPVFPLALYILINIQAYGPILGILISWLGL
    N315            MSFHQVEEWFEIFRQFGYLPGFILLYIRAIIPVFPLALYILINIQAYGPILGILISWLGL
    NCTC8325        MSFHQVEEWFEIFRQFGYLPGFILLYIRAIIPVFPLALYILINIQAYGPILGILISWLGL
    Newman          MSFHQVEEWFEIFRQFGYLPGFILLYIRAIIPVFPLALYILINIQAYGPILGILISWLGL
    USA300_FPR3757  MSFHQVEEWFEIFRQFGYLPGFILLYIRAIIPVFPLALYILINIQAYGPILGILISWLGL
                    ************************************************************

    COL             ISGTFTVYLICKRLVNTERMQRIKQRTAVQRLISFIDRQGLIPLFILLCFPFTPNTLINF
    N315            ISGTFTVYLICKRLVNTERMQRIKQRTAVQRLISFIDRQGLIPLFILLCFPFTPNTLINF
    NCTC8325        ISGTFTVYLICKRLVNTERMQRIKQRTAVQRLISFIDRQGLIPLFILLCFPFTPNTLINF
    Newman          ISGTFTVYLICKRLVNTERMQRIKQRTAVQRLISFIDRQGLIPLFILLCFPFTPNTLINF
    USA300_FPR3757  ISGTFTVYLICKRLVNTERMQRIKQRTAVQRLISFIDRQGLIPLFILLCFPFTPNTLINF
                    ************************************************************

    COL             VASLSHIRPKYYFIVLASSKLVSTIILGYLGKEITTILTHPLRGILMLVVLVVFWIVGKK
    N315            VASLSHIRPKYYFIVLASSKLVSTIILGYLGKEITTILTHPLRGILMLVVLVVFWIVGKK
    NCTC8325        VASLSHIRPKYYFIVLASSKLVSTIILGYLGKEITTILTHPLRGILMLVVLVVFWIVGKK
    Newman          VASLSHIRPKYYFIVLASSKLVSTIILGYLGKEITTILTHPLRGILMLVVLVVFWIVGKK
    USA300_FPR3757  VASLSHIRPKYYFIVLASSKLVSTIILGYLGKEITTILTHPLRGILMLVVLVVFWIVGKK
                    ************************************************************

    COL             LEQHFMGSKKE
    N315            LEQHFMGSKKE
    NCTC8325        LEQHFMGSKKE
    Newman          LEQHFMGSKKE
    USA300_FPR3757  LEQHFMGSKKE
                    ***********