From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003027000
  • symbol?:
  • description?: TIGR01457 family HAD-type hydrolase

      descriptions from strain specific annotations:

    • TIGR01457 family HAD-type hydrolase
    • HAD superfamily hydrolase
    • hydrolase
    • 4-nitrophenylphosphatase
    • HAD family hydrolase
    • HAD hydrolase, IIA family protein
    • HAD-superfamily hydrolase, subfamily IIA family protein
    • HAD-superfamily subfamily IIA hydrolase
    • haloacid dehalogenase
    • haloacid dehalogenase-like hydrolase
    • N-acetyl-glucosamine catabolism-like protein
    • NagD-like phosphatase
    • Protein nagD -like protein
    • putative NagD-like phosphatase
    • pyridoxal phosphate phosphatase
  • strand?: +
  • coordinates?: 3418528..3419307
  • synteny block?: BlockID0021350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0884
    08BA02176:
    C248_0928
    11819-97:
    MS7_0884
    71193:
    ST398NM01_0912
    ECT-R 2:
    ECTR2_785
    ED133:
    SAOV_0875
    ED98:
    SAAV_0889
    HO 5096 0412:
    SAEMRSA15_07590
    JH1:
    SaurJH1_0947
    JH9:
    SaurJH9_0928
    JKD6008:
    SAA6008_00880
    JKD6159:
    SAA6159_00788
    LGA251:
    SARLGA251_08470
    M013:
    M013TW_0848
    MRSA252:
    SAR0891
    MSHR1132:
    SAMSHR1132_07810
    MSSA476:
    SAS0799
    Mu3:
    SAHV_0924
    Mu50:
    SAV0929
    MW2:
    MW0811
    RF122:
    SAB0795
    ST398:
    SAPIG0912
    T0131:
    SAT0131_00959
    TCH60:
    HMPREF0772_12318 (pdxp)
    TW20:
    SATW20_09290
    USA300_TCH1516:
    USA300HOU_0889
    VC40:
    SAVC_03820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQYKAYLIDLDGTMYMGTDEIDGAKQFIDYLNVKGIPHLYVTNNSTKTPEQVTEKLREM
    N315            MKQYKAYLIDLDGTMYMGTDEIDGAKQFIDYLNVKGIPHLYVTNNSTKTPEQVTEKLREM
    NCTC8325        MKQYKAYLIDLDGTMYMGTDEIDGAKQFIDYLNVKGIPHLYVTNNSTKTPEQVTEKLREM
    Newman          MKQYKAYLIDLDGTMYMGTDEIDGAKQFIDYLNVKGIPHLYVTNNSTKTPEQVTEKLREM
    USA300_FPR3757  MKQYKAYLIDLDGTMYMGTDEIDGAKQFIDYLNVKGIPHLYVTNNSTKTPEQVTEKLREM
                    ************************************************************

    COL             HIDAKPEEVVTSALATADYISEQSPGASVYMLGGSGLNTALTEAGLVIKNDEHVDYVVIG
    N315            HIDAKPEEVVTSALATADYISEQSPGASVYMLGGSGLNTALTEAGLVIKNDEHVDYVVIG
    NCTC8325        HIDAKPEEVVTSALATADYISEQSPGASVYMLGGSGLNTALTEAGLVIKNDEHVDYVVIG
    Newman          HIDAKPEEVVTSALATADYISEQSPGASVYMLGGSGLNTALTEAGLVIKNDEHVDYVVIG
    USA300_FPR3757  HIDAKPEEVVTSALATADYISEQSPGASVYMLGGSGLNTALTEAGLVIKNDEHVDYVVIG
                    ************************************************************

    COL             LDEQVTYEKLAIATLGVRNGATFISTNPDVSIPKERGLLPGNGAITSVVSVSTGVSPQFI
    N315            LDEQVTYEKLAIATLGVRNGATFISTNPDVSIPKERGLLPGNGAITSVVSVSTGVSPQFI
    NCTC8325        LDEQVTYEKLAIATLGVRNGATFISTNPDVSIPKERGLLPGNGAITSVVSVSTGVSPQFI
    Newman          LDEQVTYEKLAIATLGVRNGATFISTNPDVSIPKERGLLPGNGAITSVVSVSTGVSPQFI
    USA300_FPR3757  LDEQVTYEKLAIATLGVRNGATFISTNPDVSIPKERGLLPGNGAITSVVSVSTGVSPQFI
                    ************************************************************

    COL             GKPEPIIMVKALEILGLDKSEVAMVGDLYDTDIMSGINVGMDTIHVQTGVSTLEDVQNKN
    N315            GKPEPIIMVKALEILGLDKSEVAMVGDLYDTDIMSGINVGMDTIHVQTGVSTLEDVQNKN
    NCTC8325        GKPEPIIMVKALEILGLDKSEVAMVGDLYDTDIMSGINVGMDTIHVQTGVSTLEDVQNKN
    Newman          GKPEPIIMVKALEILGLDKSEVAMVGDLYDTDIMSGINVGMDTIHVQTGVSTLEDVQNKN
    USA300_FPR3757  GKPEPIIMVKALEILGLDKSEVAMVGDLYDTDIMSGINVGMDTIHVQTGVSTLEDVQNKN
                    ************************************************************

    COL             VPPTYSFKDLNEAIAELEK
    N315            VPPTYSFKDLNEAIAELEK
    NCTC8325        VPPTYSFKDLNEAIAELEK
    Newman          VPPTYSFKDLNEAIAELEK
    USA300_FPR3757  VPPTYSFKDLNEAIAELEK
                    *******************