From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003077000
  • symbol?: addA
  • description?: ATP-dependent helicase/nuclease subunit A

      descriptions from strain specific annotations:

    • ATP-dependent helicase/nuclease subunit A
    • exonuclease RexA
    • ATP-dependent nuclease subunit A
    • ATP-dependent deoxyribonuclease subunit A
    • ATP-dependent nuclease, subunit A
    • ATP-dependent nuclease Rex subunit A
    • helicase-exonuclease AddAB, AddA subunit
    • putative helicase
    • recombination helicase AddA
  • strand?: +
  • coordinates?: 3464421..3468074
  • synteny block?: BlockID0021850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0971 (rexA)
    N315:
    NCTC8325:
    Newman:
    NWMN_0838 (rexA)
    USA300_FPR3757:
    04-02981:
    SA2981_0922
    08BA02176:
    C248_0969 (addA)
    11819-97:
    MS7_0922 (addA)
    71193:
    ST398NM01_0950
    ECT-R 2:
    ECTR2_823 (addA)
    ED133:
    SAOV_0914
    ED98:
    SAAV_0928 (rexA)
    HO 5096 0412:
    SAEMRSA15_07970
    JH1:
    SaurJH1_0986
    JH9:
    SaurJH9_0967
    JKD6008:
    SAA6008_00920 (addA)
    JKD6159:
    SAA6159_00826 (addA)
    LGA251:
    SARLGA251_08850
    M013:
    M013TW_0886
    MRSA252:
    SAR0929
    MSHR1132:
    SAMSHR1132_08190
    MSSA476:
    SAS0837
    Mu3:
    SAHV_0962
    Mu50:
    SAV0967
    MW2:
    MW0849
    RF122:
    SAB0836
    ST398:
    SAPIG0950 (addA)
    T0131:
    SAT0131_01000
    TCH60:
    HMPREF0772_12279 (addA)
    TW20:
    SATW20_09670
    USA300_TCH1516:
    USA300HOU_0926 (rexA)
    VC40:
    SAVC_04010

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTIPEKPQGVIWTDAQWQSIYATGQDVLVAAAAGSGKTAVLVERIIQKILRDGIDVDRLL
    N315            MTIPEKPQGVIWTDAQWQSIYATGQDVLVAAAAGSGKTAVLVERIIQKILRDGIDVDRLL
    NCTC8325        MTIPEKPQGVIWTDAQWQSIYATGQDVLVAAAAGSGKTAVLVERIIQKILRDGIDVDRLL
    Newman          MTIPEKPQGVIWTDAQWQSIYATGQDVLVAAAAGSGKTAVLVERIIQKILRDGIDVDRLL
    USA300_FPR3757  MTIPEKPQGVIWTDAQWQSIYATGQDVLVAAAAGSGKTAVLVERIIQKILRDGIDVDRLL
                    ************************************************************

    COL             VVTFTNLSAREMKHRVDQRIQEASIADPANAHLKNQRIKIHQAQISTLHSFCLKLIQQHY
    N315            VVTFTNLSAREMKHRVDQRIQEASIADPANAHLKNQRIKIHQAQISTLHSFCLKLIQQHY
    NCTC8325        VVTFTNLSAREMKHRVDQRIQEASIADPANAHLKNQRIKIHQAQISTLHSFCLKLIQQHY
    Newman          VVTFTNLSAREMKHRVDQRIQEASIADPANAHLKNQRIKIHQAQISTLHSFCLKLIQQHY
    USA300_FPR3757  VVTFTNLSAREMKHRVDQRIQEASIADPANAHLKNQRIKIHQAQISTLHSFCLKLIQQHY
                    ************************************************************

    COL             DVLNIDPNFRTSSEAENILLLEQTIDEVIEQHYDILDPAFIELTEQLSSDRSDDQFRMII
    N315            DVLNIDPNFRTSSEAENILLLEQTIDEVIEQHYDILDPAFIELTEQLSSDRSDDQFRMII
    NCTC8325        DVLNIDPNFRTSSEAENILLLEQTIDEVIEQHYDILDPAFIELTEQLSSDRSDDQFRMII
    Newman          DVLNIDPNFRTSSEAENILLLEQTIDEVIEQHYDILDPAFIELTEQLSSDRSDDQFRMII
    USA300_FPR3757  DVLNIDPNFRTSSEAENILLLEQTIDEVIEQHYDILDPAFIELTEQLSSDRSDDQFRMII
                    ************************************************************

    COL             KQLYFFSVANPNPTNWLDQLVTPYEEEAQQAQLIQLLTDLSKVFITAAYDALNKAYDLFS
    N315            KQLYFFSVANPNPTNWLDQLVTPYEEEAQQAQLIQLLTDLSKVFITAAYDALNKAYDLFS
    NCTC8325        KQLYFFSVANPNPTNWLDQLVTPYEEEAQQAQLIQLLTDLSKVFITAAYDALNKAYDLFS
    Newman          KQLYFFSVANPNPTNWLDQLVTPYEEEAQQAQLIQLLTDLSKVFITAAYDALNKAYDLFS
    USA300_FPR3757  KQLYFFSVANPNPKNWLDQLVTPYEEEAQQAQLIQLLTDLSKVFITAAYDALNKAYDLFS
                    *************.**********************************************

    COL             MMDSVDKHLAVIEDERRLMGRVLEGGFIDIPYLTGHEFGARLPNVTAKIKEANEMMVDAL
    N315            MMDGVDKHLAVIEDERRLMGRVLEGGFIDIPYLTDHEFGARLPNVTAKIKEANEMMVDAL
    NCTC8325        MMDSVDKHLAVIEDERRLMGRVLEGGFIDIPYLTGHEFGARLPNVTAKIKEANEMMVDAL
    Newman          MMDSVDKHLAVIEDERRLMGRVLEGGFIDIPYLTGHEFGARLPNVTAKIKEANEMMVDAL
    USA300_FPR3757  MMDSVDKHLAVIEDERRLMGRVLEGGFIDIPYLTGHEFGARLPNVTAKIKEANEMMVDAL
                    ***.******************************.*************************

    COL             EDAKLQYKKYKSLIDKVKSDYFSREADDLKADMQQLAPRVKYLARIVKDVMSEFNRKKRS
    N315            EDAKLQYKKYKSLIDKVKNDYFSREADDLKADMQQLAPRVKYLARIVKDVMSEFNRKKRS
    NCTC8325        EDAKLQYKKYKSLIDKVKSDYFSREADDLKADMQQLAPRVKYLARIVKDVMSEFNRKKRS
    Newman          EDAKLQYKKYKSLIDKVKSDYFSREADDLKADMQQLAPRVKYLARIVKDVMSEFNRKKRS
    USA300_FPR3757  EDAKLQYKKYKSLIDKVKSDYFSREADDLKADMQQLAPRVKYLARIVKDVMSEFNRKKRS
                    ******************.*****************************************

    COL             KNILDFSDYEHFALQILTNEDGSPSEIAESYRQHFQEILVDEYQDTNRVQEKILSCIKTG
    N315            KNILDFSDYEHFALQILTNEDGSPSEIAESYRQHFQEILVDEYQDTNRVQEKILSCIKTG
    NCTC8325        KNILDFSDYEHFALQILTNEDGSPSEIAESYRQHFQEILVDEYQDTNRVQEKILSCIKTG
    Newman          KNILDFSDYEHFALQILTNEDGSPSEIAESYRQHFQEILVDEYQDTNRVQEKILSCIKTG
    USA300_FPR3757  KNILDFSDYEHFALQILTNEDGSPSEIAESYRQHFQEILVDEYQDTNRVQEKILSCIKTG
                    ************************************************************

    COL             DEHNGNLFMVGDVKQSIYKFRQADPSLFIEKYQRFTIDGDGTGRRIDLSQNFRSRKEVLS
    N315            DEHNGNLFMVGDVKQSIYKFRQADPSLFIEKYQRFTIDGDGTGRRIDLSQNFRSRKEVLS
    NCTC8325        DEHNGNLFMVGDVKQSIYKFRQADPSLFIEKYQRFTIDGDGTGRRIDLSQNFRSRKEVLS
    Newman          DEHNGNLFMVGDVKQSIYKFRQADPSLFIEKYQRFTIDGDGTGRRIDLSQNFRSRKEVLS
    USA300_FPR3757  DEHNGNLFMVGDVKQSIYKFRQADPSLFIEKYQRFTIDGDGTGRRIDLSQNFRSRKEVLS
                    ************************************************************

    COL             TTNYIFKHMMDEQVGEVKYDEAAQLYYGAPYDESDHPVNLKVLVEADQEHSDLTGSEQEA
    N315            TTNYIFKHMMDEQVGEVKYDEAAQLYYGAPYDESDHPVNLKVLVEADQEHSDLTGSEQEA
    NCTC8325        TTNYIFKHMMDEQVGEVKYDEAAQLYYGAPYDESDHPVNLKVLVEADQEHSDLTGSEQEA
    Newman          TTNYIFKHMMDEQVGEVKYDEAAQLYYGAPYDESDHPVNLKVLVEADQEHSDLTGSEQEA
    USA300_FPR3757  TTNYIFKHMMDEQVGEVKYDEAAQLYYGAPYDESDHPVNLKVLVEADQEHSDLTGSEQEA
                    ************************************************************

    COL             HFIVEQVKDILEHQKVYDMKTGSYRSATYKDIVILERSFGQARNLQQAFKNEDIPFHVNS
    N315            HFIVEQVKDILEHQKVYDMKTGSYRSATYKDIVILERSFGQARNLQQAFKNEDIPFHVNS
    NCTC8325        HFIVEQVKDILEHQKVYDMKTGSYRSATYKDIVILERSFGQARNLQQAFKNEDIPFHVNS
    Newman          HFIVEQVKDILEHQKVYDMKTGSYRSATYKDIVILERSFGQARNLQQAFKNEDIPFHVNS
    USA300_FPR3757  HFIVEQVKDILEHQKVYDMKTGSYRSATYKDIVILERSFGQARNLQQAFKNEDIPFHVNS
                    ************************************************************

    COL             REGYFEQTEVRLVLSFLRAIDNPLQDIYLVGLMRSVIYQFKEDELAQIRILSPNDDYFYQ
    N315            REGYFEQTEVRLVLSFLRAIDNPLQDIYLVGLMRSVIYQFKEDELAQIRILSPNDDYFYQ
    NCTC8325        REGYFEQTEVRLVLSFLRAIDNPLQDIYLVGLMRSVIYQFKEDELAQIRILSPNDDYFYQ
    Newman          REGYFEQTEVRLVLSFLRAIDNPLQDIYLVGLMRSVIYQFKEDELAQIRILSPNDDYFYQ
    USA300_FPR3757  REGYFEQTEVRLVLSFLRAIDNPLQDIYLVGLMRSVIYQFKEDELAQIRILSPNDDYFYQ
                    ************************************************************

    COL             SIVNYINDEAADAILVDKLKMFLSDIQSYQQYSKDHPVYQLIDKFYNDHYVIQYFSGLIG
    N315            SIVNYINDEAADAILVDKLKMFLSDIQSYQQYSKDHPVYQLIDKFYNDHYVIQYFSGLIG
    NCTC8325        SIVNYINDEAADAILVDKLKMFLSDIQSYQQYSKDHPVYQLIDKFYNDHYVIQYFSGLIG
    Newman          SIVNYINDEAADAILVDKLKMFLSDIQSYQQYSKDHPVYQLIDKFYNDHYVIQYFSGLIG
    USA300_FPR3757  SIVNYINDEAADAILVDKLKMFLSDIQSYQQYSKDHPVYQLIDKFYNDHYVIQYFSGLIG
                    ************************************************************

    COL             GRGRRANLYGLFNKAIEFENSSFRGLYQFIRFIDELIERGKDFGEENVVGPNDNVVRMMT
    N315            GRGRRANLYGLFNKAIEFENSSFRGLYQFIRFIDELIERGKDFGEENVVGPNDNVVRMMT
    NCTC8325        GRGRRANLYGLFNKAIEFENSSFRGLYQFIRFIDELIERGKDFGEENVVGPNDNVVRMMT
    Newman          GRGRRANLYGLFNKAIEFENSSFRGLYQFIRFIDELIERGKDFGEENVVGPNDNVVRMMT
    USA300_FPR3757  GRGRRANLYGLFNKAIEFENSSFRGLYQFIRFIDELIERGKDFGEENVVGPNDNVVRMMT
                    ************************************************************

    COL             IHSSKGLEFPFVIYSGLSKDFNKRDLKQPVILNQQFGLGMDYFDVDKEMAFPSLASVAYR
    N315            IHSSKGLEFPFVIYSGLSKDFNKRDLKQPVILNQQFGLGMDYFDVDKEMAFPSLASVAYK
    NCTC8325        IHSSKGLEFPFVIYSGLSKDFNKRDLKQPVILNQQFGLGMDYFDVDKEMAFPSLASVAYR
    Newman          IHSSKGLEFPFVIYSGLSKDFNKRDLKQPVILNQQFGLGMDYFDVDKEMAFPSLASVAYR
    USA300_FPR3757  IHSSKGLEFPFVIYSGLSKDFNKRDLKQPVILNQQFGLGMDYFDVDKEMAFPSLASVAYR
                    ***********************************************************:

    COL             AVAEKELVSEEMRLVYVALTRAKEQLYLIGRVKNDKSLLELEQLSISGEHIAVNERLTSP
    N315            AVAEKELVSEEMRLVYVALTRAKEQLYLIGRVKNDKSLLELEQLSISGEHIAVNERLTSP
    NCTC8325        AVAEKELVSEEMRLVYVALTRAKEQLYLIGRVKNDKSLLELEQLSISGEHIAVNERLTSP
    Newman          AVAEKELVSEEMRLVYVALTRAKEQLYLIGRVKNDKSLLELEQLSISGEHIAVNERLTSP
    USA300_FPR3757  AVAEKELVSEEMRLVYVALTRAKEQLYLIGRVKNDKSLLELEQLSISGEHIAVNERLTSP
                    ************************************************************

    COL             NPFHLIYSILSKHQSASIPDDLKFEKDIAQIEDSSRPNVNISIVYFEDVSTETILDNDEY
    N315            NPFHLIYSILSKHQSASIPDDLKFEKDIAQVEDSSRPNVNISIIYFEDVSTETILDNNEY
    NCTC8325        NPFHLIYSILSKHQSASIPDDLKFEKDIAQIEDSSRPNVNISIVYFEDVSTETILDNDEY
    Newman          NPFHLIYSILSKHQSASIPDDLKFEKDIAQIEDSSRPNVNISIVYFEDVSTETILDNDEY
    USA300_FPR3757  NPFHLIYSILSKHQSASIPDDLKFEKDIAQIEDSSRPNVNISIVYFEDVSTETILDNDEY
                    ******************************:************:*************:**

    COL             RSVNQLETMQNGNEDVKAQIKHQLDYRYPYVNDTKKPSKQSVSELKRQYETEESGTSYER
    N315            RSVNQLETMQNGNEDVKAQIKHQLDYQYPYVNDTKKPSKQSVSELKRQYETEESGTSYER
    NCTC8325        RSVNQLETMQNGNEDVKAQIKHQLDYRYPYVNDTKKPSKQSVSELKRQYETEESGTSYER
    Newman          RSVNQLETMQNGNEDVKAQIKHQLDYRYPYVNDTKKPSKQSVSELKRQYETEESGTSYER
    USA300_FPR3757  RSVNQLETMQNGNEDVKAQIKHQLDYRYPYVNDTKKPSKQSVSELKRQYETEESGTSYER
                    **************************:*********************************

    COL             VRQYRIGFSTYERPKFLSEQGKRKANEIGTLMHTVMQHLPFKKERISEVELHQYIDGLID
    N315            VRQYRIGFSTYERPKFLSEQGKRKANEIGTLMHTVMQHLPFKKERISEVELHQYIDGLID
    NCTC8325        VRQYRIGFSTYERPKFLSEQGKRKANEIGTLMHTVMQHLPFKKERISEVELHQYIDGLID
    Newman          VRQYRIGFSTYERPKFLSEQGKRKANEIGTLMHTVMQHLPFKKERISEVELHQYIDGLID
    USA300_FPR3757  VRQYRIGFSTYERPKFLSEQGKRKANEIGTLMHTVMQHLPFKKERISEVELHQYIDGLID
                    ************************************************************

    COL             KHIIEADAKKDIRMDEIMTFINSELYSIIAEAEQVYRELPFVVNQALVDQLPQGDEDVSI
    N315            KHIIEADAKKDIRMDEIMTFINSELYSIIAEAEQVYRELPFVVNQALVDQLPQGDEDVSI
    NCTC8325        KHIIEADAKKDIRMDEIMTFINSELYSIIAEAEQVYRELPFVVNQALVDQLPQGDEDVSI
    Newman          KHIIEADAKKDIRMDEIMTFINSELYSIIAEAEQVYRELPFVVNQALVDQLPQGDEDVSI
    USA300_FPR3757  KHIIEADAKKDIRMDEIMTFINSELYSIIAEAEQVYRELPFVVNQALVDQLPQGDEDVSI
                    ************************************************************

    COL             IQGMIDLIFVKDGVHYFVDYKTDAFNRRRGMTDEEIGTQLKNKYKIQMKYYQNTLQTILN
    N315            IQGMIDLIFVKDGVHYFVDYKTDAFNRRRGMTDEEIGTQLKNKYKIQMKYYQNTLQTILN
    NCTC8325        IQGMIDLIFVKDGVHYFVDYKTDAFNRRRGMTDEEIGTQLKNKYKIQMKYYQNTLQTILN
    Newman          IQGMIDLIFVKDGVHYFVDYKTDAFNRRRGMTDEEIGTQLKNKYKIQMKYYQNTLQTILN
    USA300_FPR3757  IQGMIDLIFVKDGVHYFVDYKTDAFNRRRGMTDEEIGTQLKNKYKIQMKYYQNTLQTILN
                    ************************************************************

    COL             KEVKGYLYFFKFGTLQL
    N315            KEVKGYLYFFKFGTLQL
    NCTC8325        KEVKGYLYFFKFGTLQL
    Newman          KEVKGYLYFFKFGTLQL
    USA300_FPR3757  KEVKGYLYFFKFGTLQL
                    *****************