From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003156000
  • symbol?: opp-4C
  • description?: oligopeptide ABC transporter permease

      descriptions from strain specific annotations:

    • oligopeptide ABC transporter permease
    • peptide ABC transporter permease
    • ABC transporter permease
    • binding--dependent transport system inner membrane component family protein
    • binding-protein-dependent transport systems inner membrane component
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein
    • oligopeptide ABC superfamily ATP binding cassette transporter, permease protein
    • Oligopeptide ABC transporter, permease protein
    • oligopeptide ABC transporter membrane protein
    • Oligopeptide transport system permease OppC
    • oligopeptide transport system permease protein appC
    • Oligopeptide transport system permease protein oppC
    • putative oligopeptide transport system permease
  • strand?: +
  • coordinates?: 3548552..3549436
  • synteny block?: BlockID0022440
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0950 (oppC)
    08BA02176:
    11819-97:
    MS7_0951
    71193:
    ECT-R 2:
    ECTR2_850
    ED133:
    SAOV_0941
    ED98:
    SAAV_0956
    HO 5096 0412:
    SAEMRSA15_08240 (appC)
    JH1:
    SaurJH1_1013
    JH9:
    SaurJH9_0994
    JKD6008:
    SAA6008_00948
    JKD6159:
    LGA251:
    SARLGA251_09110 (appC)
    M013:
    M013TW_0917
    MRSA252:
    SAR0960 (appC)
    MSHR1132:
    SAMSHR1132_08430
    MSSA476:
    SAS0865
    Mu3:
    SAHV_0990
    Mu50:
    SAV0995
    MW2:
    MW0877
    RF122:
    ST398:
    T0131:
    SAT0131_01030 (rpmE2)
    TCH60:
    HMPREF0772_12246 (appC)
    TW20:
    SATW20_09930 (appC)
    USA300_TCH1516:
    USA300HOU_0953 (oppC3)
    VC40:
    SAVC_04145

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQNKSKSPFKIAFSKFIHNKIAMLSVIFLLIITIVSIIAPLIAPFPVNQQDLLNIKGEMT
    N315            MQNKSKSPFKIALSRFIHNKIAMLSIIFLLIITIVSIIAPLIAPFPVNQQDLLNIKGEMT
    NCTC8325        MQNKSKSPFKIAFSKFIHNKIAMLSVIFLLIITIVSIIAPLIAPFPVNQQDLLNIKGEMT
    Newman          MQNKSKSPFKIAFSKFIHNKIAMLSVIFLLIITIVSIIAPLIAPFPVNQQDLLNIKGEMT
    USA300_FPR3757  MQNKSKSPFKIAFSKFIHNKIAMLSVIFLLIITIVSIIAPLIAPFPVNQQDLLNIKGEMT
                    ************:*:**********:**********************************

    COL             AQNILGTDSGGRDNFSRLLYAGRISLSIGITSTIGMLLIGITVGVISGYFGGIVDTLLMR
    N315            AQNILGTDSGGRDNFSRLLYAGRISLSIGITSTIGMLLIGITVGVISGYFGGIVDTLLMR
    NCTC8325        AQNILGTDSGGRDNFSRLLYAGRISLSIGITSTIGMLLIGITVGVISGYFGGIVDTLLMR
    Newman          AQNILGTDSGGRDNFSRLLYAGRISLSIGITSTIGMLLIGITVGVISGYFGGIVDTLLMR
    USA300_FPR3757  AQNILGTDSGGRDNFSRLLYAGRISLSIGITSTIGMLLIGITVGVISGYFGGIVDTLLMR
                    ************************************************************

    COL             ITEFVMLFPFLIFAIVLNAALGDKIKNPYGSAIILVLVIIVLSWGGIARLVRGKVLQEKE
    N315            ITEFVMLFPFLIFAIVLNAALGDKIKNPYGSAIILVLVIIVLSWGGIARLVRGKVLQEKE
    NCTC8325        ITEFVMLFPFLIFAIVLNAALGDKIKNPYGSAIILVLVIIVLSWGGIARLVRGKVLQEKE
    Newman          ITEFVMLFPFLIFAIVLNAALGDKIKNPYGSAIILVLVIIVLSWGGIARLVRGKVLQEKE
    USA300_FPR3757  ITEFVMLFPFLIFAIVLNAALGDKIKNPYGSAIILVLVIIVLSWGGIARLVRGKVLQEKE
                    ************************************************************

    COL             NEYFLAAKSIGTPTYKIILKHLLPNILSVVIVQATLLFAGMIVVESGLSFLGFGISKAIP
    N315            NEYFLAAKSIGTPTYKIILKHLLPNILSVVIVQATLLFAGMIVVESGLSFLGFGISKAIP
    NCTC8325        NEYFLAAKSIGTPTYKIILKHLLPNILSVVIVQATLLFAGMIVVESGLSFLGFGISKAIP
    Newman          NEYFLAAKSIGTPTYKIILKHLLPNILSVVIVQATLLFAGMIVVESGLSFLGFGISKAIP
    USA300_FPR3757  NEYFLAAKSIGTPTYKIILKHLLPNILSVVIVQATLLFAGMIVVESGLSFLGFGISKAIP
                    ************************************************************

    COL             SWGNMLSDAQEGDVISGKPWIWMPPAIMITLTILSINFVGEGIKDAFNPRGRR
    N315            SWGNMLSDAQEGDVISGKPWIWMPPAIMITLTILSINFVGEGLKDAFNPRGRR
    NCTC8325        SWGNMLSDAQEGDVISGKPWIWMPPAIMITLTILSINFVGEGIKDAFNPRGRR
    Newman          SWGNMLSDAQEGDVISGKPWIWMPPAIMITLTILSINFVGEGIKDAFNPRGRR
    USA300_FPR3757  SWGNMLSDAQEGDVISGKPWIWMPPAIMITLTILSINFVGEGIKDAFNPRGRR
                    ******************************************:**********