From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0854 [new locus tag: SA_RS04840 ]
  • pan locus tag?: SAUPAN003156000
  • symbol: SA0854
  • pan gene symbol?: opp-4C
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0854 [new locus tag: SA_RS04840 ]
  • symbol: SA0854
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 968629..969510
  • length: 882
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGCAAAATAAGTCAAAATCGCCTTTTAAAATTGCATTGTCTAGATTTATTCATAATAAA
    ATTGCAATGTTATCGATTATTTTTTTATTAATCATAACTATTGTATCAATTATAGCGCCA
    TTAATAGCTCCTTTTCCAGTGAACCAACAAGATTTATTAAATATAAAAGGTGAAATGACA
    GCACAAAACATTCTTGGTACAGACTCTGGTGGTAGGGATAACTTTAGTCGTTTGTTATAT
    GCAGGTCGTATTTCATTATCCATTGGAATTACATCTACAATAGGAATGCTTTTGATTGGA
    ATTACAGTTGGAGTGATTTCTGGTTATTTTGGAGGTATTGTTGATACATTATTAATGAGA
    ATAACCGAATTTGTTATGTTATTTCCATTTTTAATATTTGCAATTGTATTAAATGCTGCA
    CTTGGAGATAAAATTAAAAATCCTTATGGATCTGCCATAATTCTTGTTCTAGTTATTATC
    GTATTAAGTTGGGGAGGTATTGCAAGACTTGTTCGTGGTAAAGTACTTCAAGAAAAAGAA
    AATGAATACTTTTTGGCAGCAAAATCAATTGGTACACCCACATATAAAATTATTTTGAAA
    CATCTTTTGCCGAATATATTAAGTGTAGTTATCGTACAAGCAACATTGTTATTTGCCGGT
    ATGATTGTAGTGGAATCAGGATTGAGCTTTTTAGGATTCGGAATTAGTAAAGCAATACCA
    TCTTGGGGTAATATGTTGAGTGATGCTCAAGAAGGGGATGTTATAAGTGGTAAACCGTGG
    ATATGGATGCCACCTGCTATAATGATTACATTAACTATATTAAGTATAAACTTTGTAGGG
    GAAGGGCTTAAAGATGCTTTTAATCCTAGAGGTAGACGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    882

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0854 [new locus tag: SA_RS04840 ]
  • symbol: SA0854
  • description: hypothetical protein
  • length: 293
  • theoretical pI: 10.4338
  • theoretical MW: 31827.9
  • GRAVY: 0.722526

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel ABC transporter, permease subunit NikC (TIGR02790; EC 3.6.3.24; HMM-score: 204.3)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel ABC transporter, permease subunit NikB (TIGR02789; EC 3.6.3.24; HMM-score: 22.3)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, permease protein CysT (TIGR02139; HMM-score: 19)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, permease protein (TIGR03262; HMM-score: 16)
  • TheSEED:  
    Membrane TransportABC transportersABC transporter oligopeptide (TC 3.A.1.5.1) Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1) 
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 108.1)
    no clan definedOppC_N; N-terminal TM domain of oligopeptide transport permease C (PF12911; HMM-score: 43.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.214
    • Ymax_pos: 11
    • Cmax: 0.116
    • Cmax_pos: 40
    • Smax: 0.604
    • Smax_pos: 1
    • Smean: 0.433
    • D: 0.3
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MQNKSKSPFKIALSRFIHNKIAMLSIIFLLIITIVSIIAPLIAPFPVNQQDLLNIKGEMTAQNILGTDSGGRDNFSRLLYAGRISLSIGITSTIGMLLIGITVGVISGYFGGIVDTLLMRITEFVMLFPFLIFAIVLNAALGDKIKNPYGSAIILVLVIIVLSWGGIARLVRGKVLQEKENEYFLAAKSIGTPTYKIILKHLLPNILSVVIVQATLLFAGMIVVESGLSFLGFGISKAIPSWGNMLSDAQEGDVISGKPWIWMPPAIMITLTILSINFVGEGLKDAFNPRGRR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]