From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003180000
  • symbol?: mgtE
  • description?: putative divalent cation transport protein

      descriptions from strain specific annotations:

    • putative divalent cation transport protein
    • Mg2 transporter
    • magnesium transporter
    • Mg2+/Co2+ transporter
    • MgtE family magnesium (Mg2+)/cobalt (Co2+) transporter-E
    • MgtE family magnesium transporter
    • Mg2+ transporter
  • strand?: +
  • coordinates?: 3570209..3571618
  • synteny block?: BlockID0022670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1013 (mgtE)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0963
    08BA02176:
    C248_1031 (mgtE)
    11819-97:
    MS7_0964 (mgtE)
    71193:
    ST398NM01_1004
    ECT-R 2:
    ECTR2_863 (mgtE)
    ED133:
    SAOV_0954
    ED98:
    SAAV_0971 (mgtE)
    HO 5096 0412:
    SAEMRSA15_08390
    JH1:
    SaurJH1_1026
    JH9:
    SaurJH9_1007
    JKD6008:
    SAA6008_00962 (mgtE)
    JKD6159:
    SAA6159_00865 (mgtE)
    LGA251:
    SARLGA251_09240
    M013:
    M013TW_0931
    MRSA252:
    SAR0976
    MSHR1132:
    SAMSHR1132_08560
    MSSA476:
    SAS0878
    Mu3:
    SAHV_1003
    Mu50:
    SAV1009
    MW2:
    MW0890
    RF122:
    SAB0875
    ST398:
    SAPIG1004 (mgtE)
    T0131:
    SAT0131_01044
    TCH60:
    HMPREF0772_12228 (mgtE)
    TW20:
    SATW20_10060
    USA300_TCH1516:
    USA300HOU_0966 (mgtE)
    VC40:
    SAVC_04210

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSMNTDEKERVQEELYDQTLLDQYLENDDIDQFRDEFLALHTYEQSEYFEDTTDENRQKI
    N315            MSMNTDEKERVQEELYDETLLDQYLENDDIDQFRDEFLALHTYEQSEYFEDTTDENRQKI
    NCTC8325        MSMNTDEKERVQEELYDQTLLDQYLENDDIDQFRDEFLALHTYEQSEYFEDTTDENRQKI
    Newman          MSMNTDEKERVQEELYDQTLLDQYLENDDIDQFRDEFLALHTYEQSEYFEDTTDENRQKI
    USA300_FPR3757  MSMNTDEKERVQEELYDQTLLDQYLENDDIDQFRDEFLALHTYEQSEYFEDTTDENRQKI
                    *****************:******************************************

    COL             FQYLSPEEVANFFDQLDIDDDEYELLFDKMNATYASHILEEMSYDNAVDILNELTKPKVA
    N315            FQYLSPEEVANFFDQLDIDDDEYELLFDKMNATYASHILEEMSYDNAVDILNELTKPKVA
    NCTC8325        FQYLSPEEVANFFDQLDIDDDEYELLFDKMNATYASHILEEMSYDNAVDILNELTKPKVA
    Newman          FQYLSPEEVANFFDQLDIDDDEYELLFDKMNATYASHILEEMSYDNAVDILNELTKPKVA
    USA300_FPR3757  FQYLSPEEVANFFDQLDIDDDEYELLFDKMNATYASHILEEMSYDNAVDILNELTKPKVA
                    ************************************************************

    COL             SLLTLMNKDDANEIKALLHYDEDTAGGIMTTEYLSLKAHTPVKEALLLVKAQAPDAETIY
    N315            SLLTLMNKDDANEIKALLHYDEDTAGGIMTTEYLSLKAHTPVKEALLLVKAQAPDAETIY
    NCTC8325        SLLTLMNKDDANEIKALLHYDEDTAGGIMTTEYLSLKAHTPVKEALLLVKAQAPDAETIY
    Newman          SLLTLMNKDDANEIKALLHYDEDTAGGIMTTEYLSLKAHTPVKEALLLVKAQAPDAETIY
    USA300_FPR3757  SLLTLMNKDDANEIKALLHYDEDTAGGIMTTEYLSLKAHTPVKEALLLVKAQAPDAETIY
                    ************************************************************

    COL             VIFVVDDDGKLVGVLSLRDLIVAENDAYIEDIMNERVISVNVADDQEDVAQVMRDYDFMA
    N315            VIFVVDDDGKLVGVLSLRDLIVAENDAYIEDIMNERVISVNVADDQEDVAQVMRDYDFMA
    NCTC8325        VIFVVDDDGKLVGVLSLRDLIVAENDAYIEDIMNERVISVNVADDQEDVAQVMRDYDFMA
    Newman          VIFVVDDDGKLVGVLSLRDLIVAENDAYIEDIMNERVISVNVADDQEDVAQVMRDYDFMA
    USA300_FPR3757  VIFVVDDDGKLVGVLSLRDLIVAENDAYIEDIMNERVISVNVADDQEDVAQVMRDYDFMA
                    ************************************************************

    COL             VPVIDYQEHLLGIITIDDILDVMDEEASEDYSRLAGVSDIDSTNDSIIKTALKRLPWLII
    N315            VPVIDYQEHLLGIITIDDILDVMDEEASEDYSRLAGVSDIDSTNDSIIKTALKRLPWLII
    NCTC8325        VPVIDYQEHLLGIITIDDILDVMDEEASEDYSRLAGVSDIDSTNDSIIKTALKRLPWLII
    Newman          VPVIDYQEHLLGIITIDDILDVMDEEASEDYSRLAGVSDIDSTNDSIIKTALKRLPWLII
    USA300_FPR3757  VPVIDYQEHLLGIITIDDILDVMDEEASEDYSRLAGVSDIDSTNDSIIKTALKRLPWLII
                    ************************************************************

    COL             LTFLGMITATILGRFEKTLENVALLAAFIPIISGMSGNSGTQSLAVSVRNITTGEINEQS
    N315            LTFLGMITATILGRFEKTLENVALLAAFIPIISGMSGNSGTQSLAVSVRNITTGEINEQS
    NCTC8325        LTFLGMITATILGRFEKTLENVALLAAFIPIISGMSGNSGTQSLAVSVRNITTGEINEQS
    Newman          LTFLGMITATILGRFEKTLENVALLAAFIPIISGMSGNSGTQSLAVSVRNITTGEINEQS
    USA300_FPR3757  LTFLGMITATILGRFEKTLENVALLAAFIPIISGMSGNSGTQSLAVSVRNITTGEINEQS
                    ************************************************************

    COL             KFRIALREAGSGVLSGVVCSTILFTIIVAIYHQPLLALIVAGSLTCAMTVGTFVGSMIPL
    N315            KFRIALREAGSGVLSGVVCSTILFTIIVAIYHQPLLALIVAGSLTCAMTVGTFVGSMIPL
    NCTC8325        KFRIALREAGSGVLSGVVCSTILFTIIVAIYHQPLLALIVAGSLTCAMTVGTFVGSMIPL
    Newman          KFRIALREAGSGVLSGVVCSTILFTIIVAIYHQPLLALIVAGSLTCAMTVGTFVGSMIPL
    USA300_FPR3757  KFRIALREAGSGVLSGVVCSTILFTIIVAIYHQPLLALIVAGSLTCAMTVGTFVGSMIPL
                    ************************************************************

    COL             LMNKLNIDPAVASGPFITTINDIISMLIYFGLATSFMAYLI
    N315            LMNKLNIDPAVASGPFITTINDIISMLIYFGLATSFMAYLI
    NCTC8325        LMNKLNIDPAVASGPFITTINDIISMLIYFGLATSFMAYLI
    Newman          LMNKLNIDPAVASGPFITTINDIISMLIYFGLATSFMAYLI
    USA300_FPR3757  LMNKLNIDPAVASGPFITTINDIISMLIYFGLATSFMAYLI
                    *****************************************