Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003203000
  • symbol?: htrA2
  • description?: serine protease HtrA

      descriptions from strain specific annotations:

    • serine protease HtrA
    • peptidase S1 and S6, chymotrypsin/Hap
    • peptidase S1 and S6 chymotrypsin/Hap
    • Serine protease htrA-like protein
    • Serine protease, DegP/HtrA, do-like protein
    • trypsin family protein
    • putative protease
    • Trypsin-like serine protease
    • serine proteinase
    • trypsin domain protein
  • strand?: +
  • coordinates?: 3592890..3595475
  • synteny block?: BlockID0022900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1028 (htrA)
    N315:
    SA0879 (htrA)
    NCTC8325:
    Newman:
    NWMN_0892 (htrA)
    USA300_FPR3757:
    04-02981:
    SA2981_0976 (htrA)
    08BA02176:
    C248_1045
    11819-97:
    MS7_0978
    71193:
    ST398NM01_1018
    ECT-R 2:
    ECTR2_877
    ED133:
    SAOV_0966
    ED98:
    SAAV_0985
    HO 5096 0412:
    SAEMRSA15_08520
    JH1:
    SaurJH1_1103
    JH9:
    SaurJH9_1081
    JKD6008:
    SAA6008_00977
    JKD6159:
    SAA6159_00878
    LGA251:
    SARLGA251_09370 (htrA2)
    M013:
    M013TW_0949
    MRSA252:
    SAR0992
    MSHR1132:
    SAMSHR1132_08690
    MSSA476:
    SAS0955
    Mu3:
    SAHV_1016 (htrA)
    Mu50:
    SAV1023 (htrA)
    MW2:
    MW0903 (htrA)
    RF122:
    SAB0888
    ST398:
    SAPIG1018
    T0131:
    SAT0131_01057
    TCH60:
    HMPREF0772_12212 (htrA)
    TW20:
    SATW20_10190 (htrA2)
    USA300_TCH1516:
    USA300HOU_0980
    VC40:
    SAVC_04275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKD
    N315            -----MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKD
    NCTC8325        MEWTLVDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKD
    Newman          MEWTLVDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKD
    USA300_FPR3757  -----MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKD
                         :******************************************************

    COL             SIDKHERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDS
    N315            SIDKHERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDS
    NCTC8325        SIDKHERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDS
    Newman          SIDKHERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDS
    USA300_FPR3757  SIDKHERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDS
                    ************************************************************

    COL             VDQDTEKSKYYEQNSEATLSTKSTDKVESTEMRKLSSDKNKVGHEEQHVLSKPSEHDKET
    N315            VDQDTEKSKYYEQNSEATLSTKSTDKVESTEMRKLSSDKNKVGHEEQHVLSKPSEHDKET
    NCTC8325        VDQDTEKSKYYEQNSEATLSTKSTDKVESTEMRKLSSDKNKVGHEEQHVLSKPSEHDKET
    Newman          VDQDTEKSKYYEQNSEATLSTKSTDKVESTEMRKLSSDKNKVGHEEQHVLSKPSEHDKET
    USA300_FPR3757  VDQDTVKSKYYEQNSEATLSTKSTDKVESTEMRKLSSDKNKVGHEEQHVLSKPSEHDKET
                    ***** ******************************************************

    COL             RIDSESSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKP
    N315            RIDSESSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKP
    NCTC8325        RIDSESSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKP
    Newman          RIDSESSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKP
    USA300_FPR3757  RIDSESSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKP
                    ************************************************************

    COL             LTLPEEQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHIPSISDDKDNVMRENHIV
    N315            LTLPEEQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHTPSISDDKDNVMRENHIV
    NCTC8325        LTLPEEQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHIPSISDDKDNVMRENHIV
    Newman          LTLPEEQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHIPSISDDKDNVMRENHIV
    USA300_FPR3757  LTLPEEQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHIPSISDDKDNVMRENHIV
                    ****************************************** *****************

    COL             DDNPDNDINTPSLSKTDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSTASHRSTEKRNI
    N315            DDNPDNDINTLSLSKIDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSTASHRSTEKRNI
    NCTC8325        DDNPDNDINTPSLSKTDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSTASHRSTEKRNI
    Newman          DDNPDNDINTPSLSKTDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSTASHRSTEKRNI
    USA300_FPR3757  DDNPDNDINTPSLSKTDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSTASHRSTEKRNI
                    ********** **** ********************************************

    COL             SINDHDKLNGQKTNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMG
    N315            SINDHDKLNGQKTNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMG
    NCTC8325        SINDHDKLNGQKTNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMG
    Newman          SINDHDKLNGQKTNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMG
    USA300_FPR3757  SINDHDKLNGQKTNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMG
                    ************************************************************

    COL             IIILIVILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLP
    N315            IIILIVILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLP
    NCTC8325        IIILIVILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLP
    Newman          IIILIVILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLP
    USA300_FPR3757  IIILIVILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLP
                    ************************************************************

    COL             KDKASQDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDL
    N315            KDKASQDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDL
    NCTC8325        KDKASQDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDL
    Newman          KDKASQDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDL
    USA300_FPR3757  KDKASQDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDL
                    ************************************************************

    COL             AVVKATSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDF
    N315            AVVKATSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDF
    NCTC8325        AVVKATSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDF
    Newman          AVVKATSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDF
    USA300_FPR3757  AVVKATSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDF
                    ************************************************************

    COL             DKDNKYDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEV
    N315            DKDNKYDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEV
    NCTC8325        DKDNKYDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEV
    Newman          DKDNKYDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEV
    USA300_FPR3757  DKDNKYDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEV
                    ************************************************************

    COL             QKIVKDLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQS
    N315            QKIVKDLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQS
    NCTC8325        QKIVKDLETKGKIDYPDVGVKMKNIVSLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQS
    Newman          QKIVKDLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQS
    USA300_FPR3757  QKIVKDLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQS
                    *************************.**********************************

    COL             GLKKGDVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
    N315            GLKKGDVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
    NCTC8325        GLKKGDVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
    Newman          GLKKGDVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
    USA300_FPR3757  GLKKGDVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
                    ******************************************************