From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003244000
  • symbol?: menF
  • description?: isochorismate synthase

      descriptions from strain specific annotations:

    • isochorismate synthase
    • isochorismate synthase family protein
    • Menaquinone-specific isochorismate synthase
    • chorismate binding protein
    • isochorismate synthases family protein
    • menaquinone-specific isochorismate
    • putative chorismate binding enzyme
    • salicylate biosynthesis isochorismate synthase
  • strand?: +
  • coordinates?: 3620279..3621649
  • synteny block?: BlockID0023280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0997
    08BA02176:
    C248_1067
    11819-97:
    MS7_1000
    71193:
    ST398NM01_1040
    ECT-R 2:
    ECTR2_898 (menF)
    ED133:
    SAOV_0988
    ED98:
    SAAV_1006
    HO 5096 0412:
    SAEMRSA15_08740
    JH1:
    SaurJH1_1124
    JH9:
    SaurJH9_1101
    JKD6008:
    SAA6008_00997 (menF)
    JKD6159:
    SAA6159_00899 (menF)
    LGA251:
    SARLGA251_09570
    M013:
    M013TW_0972
    MRSA252:
    SAR1016
    MSHR1132:
    SAMSHR1132_08910
    MSSA476:
    SAS0978
    Mu3:
    SAHV_1035
    Mu50:
    SAV1042
    MW2:
    MW0926
    RF122:
    SAB0909
    ST398:
    SAPIG1040
    T0131:
    SAT0131_01077
    TCH60:
    HMPREF0772_12193 (menF)
    TW20:
    SATW20_10390
    USA300_TCH1516:
    USA300HOU_0990 (menF)
    VC40:
    SAVC_04380

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------------------------------------------------MRLNDNR
    N315            ---MATGVLEDDIVKEIYGSSKEWVSVEVKLSQSLDPSTLFHLTDNEAGDRFYMRLNDNR
    NCTC8325        -----------------------------------------------------MRLNDNR
    Newman          MKWMATGVLEDDIVKEIYGSSKEWVSVEVKLSQSLDPSTLFHLTDNEAGDRFYMRLNDNR
    USA300_FPR3757  -----------------------------------------------------MRLNDNR
                                                                         *******

    COL             TSYFGYKAIQLFKNNSKNKQSIFKDWEKLKHNITFIHPQSEKHHLRVVGGFQFSSHKSDD
    N315            TSYFGYKAIQLFKNNSKNKQSIFKDWEKLKHNITFIHPQSEKHHLRVVGGFQFSSHKSDD
    NCTC8325        TSYFGYKAIQLFKNNSKNKQSIFKDWEKLKHNITFIHPQSEKHHLRVVGGFQFSSHKSDD
    Newman          TSYFGYKAIQLFKNNSKNKQSIFKDWEKLKHNITFIHPQSEKHHLRVVGGFQFSSHKSDD
    USA300_FPR3757  TSYFGYKAIQLFKNNSKNKQSIFKDWEKLKHNITFIHPQSEKHHLRVVGGFQFSSHKSDD
                    ************************************************************

    COL             EWREFGLNHFVLPEVLISTDNNGTFLTYTVKRESFTVEALNDLMDLFNNISDIDVDEQIG
    N315            EWREFGLNHFVLPEVLISTDNNGTFLTYTVKRESFTVEALNDLMDLFNNISDIDVDEQIG
    NCTC8325        EWREFGLNHFVLPEVLISTDNNGTFLTYTVKRESFTVEALNDLMDLFNNISDIDVDEQIG
    Newman          EWREFGLNHFVLPEVLISTDNNGTFLTYTVKRESFTVEALNDLMDLFNNISDIDVDEQIG
    USA300_FPR3757  EWREFGLNHFVLPEVLISTDNNGTFLTYTVKRESFTVEALNDLMDLFNNISDIDVDEQIG
                    ************************************************************

    COL             EITRNEDIYKDDWRQLVVEAIESINNEEKIVLARRRLIKFDKDISIPYILKQAYSKEKNS
    N315            EITRNEDIYKDDWRQLVVEAIESINNEEKIVLARRRLIKFDKDISIPYILKQAYSKEKNS
    NCTC8325        EITRNEDIYKDDWRQLVVEAIESINNEEKIVLARRRLIKFDKDISIPYILKQAYSKEKNS
    Newman          EITRNEDIYKDDWRQLVVEAIESINNEEKIVLARRRLIKFDKDISIPYILKQAYSKEKNS
    USA300_FPR3757  GITRNEDIYKDDWRQLVVEAIESINNEEKIVLARRRLIKFDKDISIPYILKQAYSKEKNS
                     ***********************************************************

    COL             YIFLLESQDSIFFSQTPEQLIKVNNKILSTKAVAGTIKRSQDEDEDTKNVEAFLKDNKNL
    N315            YIFLLESQDSIFFSQTPEQLIKVNNKILSTKAVAGTIKRSQDEDEDTKNVEAFLKDNKNL
    NCTC8325        YIFLLESQDSIFFSQTPEQLIKVNNKILSTKAVAGTIKRSQDEDEDTKNVEAFLKDNKNL
    Newman          YIFLLESQDSIFFSQTPEQLIKVNNKILSTKAVAGTIKRSQDEDEDTKNVEAFLKDNKNL
    USA300_FPR3757  YIFLLESQDSIFFSQTPEQLIKVNNKILSTKAVAGTIKRSQDEDEDTKNVEAFLKDNKNL
                    ************************************************************

    COL             IEHRFVVDSILHDIKPYITELHYDKTPKILKNDHLYHLYTEIKAPLKDDSYISLIDNLHP
    N315            IEHRFVVDSILHDIKPYITELHYDKTPKILKNDHLYHLYTEIKAPLKDDSYISLIDHLHP
    NCTC8325        IEHRFVVDSILHDIKPYITELHYDKTPKILKNDHLYHLYTEIKAPLKDDSYISLIDNLHP
    Newman          IEHRFVVDSILHDIKPYITELHYDKTPKILKNDHLYHLYTEIKAPLKDDSYISLIDNLHP
    USA300_FPR3757  IEHRFVVDSILHDIKPYITELHYDKTPKILKNDHLYHLYTEIKAPLKDDSYISLIDNLHP
                    ********************************************************:***

    COL             TPALGGYPKEFAMDFIEQKEFGTRGLYGAPVGYIDIYDDCEFIVAIRSMLIKKAQATLFA
    N315            TPALGGYPKEFAMDFIEQKEFGTRGLYGAPVGYIDIYDDCEFIVAIRSMLIKKAQATLFA
    NCTC8325        TPALGGYPKEFAMDFIEQKEFGTRGLYGAPVGYIDIYDDCEFIVAIRSMLIKKAQATLFA
    Newman          TPALGGYPKEFAMDFIEQKEFGTRGLYGAPVGYIDIYDDCEFIVAIRSMLIKKAQATLFA
    USA300_FPR3757  TPALGGYPKEFAMDFIEQKEFGTRGLYGAPVGYIDIYDDCEFIVAIRSMLIKKAQATLFA
                    ************************************************************

    COL             GCGIVKDSDPDSELAETNLKFTPMMNALGVDMNGKS
    N315            GCGIVKDSDPDSELAETNLKFTPMMNALGVDMNGKS
    NCTC8325        GCGIVKDSDPDSELAETNLKFTPMMNALGVDMNGKS
    Newman          GCGIVKDSDPDSELAETNLKFTPMMNALGVDMNGKS
    USA300_FPR3757  GCGIVKDSDPDSELAETNLKFTPMMNALGVDMNGKS
                    ************************************