From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003249000
  • symbol?: sspC
  • description?: cysteine protease

      descriptions from strain specific annotations:

    • cysteine protease
    • sspC protein
    • Staphostatin B
    • staphostatin B (Staphylococcal cysteine protease B inhibitor)
    • cysteine protease precursor
    • I57 family staphostatin B
    • chain A, Staphostatins Resemble Lipocalins, Not Cystatins In Fold
  • strand?: -
  • coordinates?: 3625716..3626049
  • synteny block?: BlockID0023330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1055 (sspC)
    N315:
    SA0899 (sspC)
    NCTC8325:
    Newman:
    NWMN_0916 (sspC)
    USA300_FPR3757:
    04-02981:
    SA2981_1001 (sspC)
    08BA02176:
    C248_1071 (sspC)
    11819-97:
    MS7_1004 (sspC)
    71193:
    ST398NM01_1044
    ECT-R 2:
    ECTR2_902
    ED133:
    SAOV_0992c
    ED98:
    SAAV_1010 (sspC)
    HO 5096 0412:
    SAEMRSA15_08780 (sspC)
    JH1:
    SaurJH1_1128
    JH9:
    SaurJH9_1105
    JKD6008:
    SAA6008_01001
    JKD6159:
    SAA6159_00903
    LGA251:
    SARLGA251_09610 (sspC)
    M013:
    M013TW_0976
    MRSA252:
    SAR1020 (sspC)
    MSHR1132:
    SAMSHR1132_08950
    MSSA476:
    SAS0982
    Mu3:
    SAHV_1039 (sspC)
    Mu50:
    SAV1046 (sspC)
    MW2:
    MW0930 (sspC)
    RF122:
    SAB0913c (sspC)
    ST398:
    SAPIG1044
    T0131:
    SAT0131_01081
    TCH60:
    HMPREF0772_12188 (sspC)
    TW20:
    SATW20_10430 (sspC)
    USA300_TCH1516:
    USA300HOU_0994 (sspC)
    VC40:
    SAVC_04400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
    N315            MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
    NCTC8325        MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
    Newman          MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
    USA300_FPR3757  MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
                    ************************************************************

    COL             AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
    N315            AHQRIKFSSIDNEEITYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
    NCTC8325        AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
    Newman          AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
    USA300_FPR3757  AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
                    *************** *********************************