From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003251000
  • symbol?: sspA
  • description?: serine protease

      descriptions from strain specific annotations:

    • serine protease
    • V8 protease
    • serine protease; V8 protease; glutamyl endopeptidase
    • glutamyl endopeptidase
    • V8 protease, glutamyl endopeptidase precursor
    • Glutamyl endopeptidase precursor, serine proteinase SspA
    • glutamyl endopeptidase (Staphylococcal serineproteinase) (V8 protease) (V8 proteinase) (Endoproteinase Glu-C)
    • glutamyl endopeptidase serine protease
    • pseudogene
    • trypsin family protein
  • strand?: -
  • coordinates?: 3627357..3628420
  • synteny block?: BlockID0023350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1057 (sspA)
    N315:
    SA0901 (sspA)
    NCTC8325:
    Newman:
    NWMN_0918 (sspA)
    USA300_FPR3757:
    04-02981:
    SA2981_1003 (sspA)
    08BA02176:
    C248_1073 (sspA)
    11819-97:
    MS7_1006 (sspA)
    71193:
    ST398NM01_1046
    ECT-R 2:
    ECTR2_904
    ED133:
    SAOV_0994c
    ED98:
    SAAV_1012 (sspA)
    HO 5096 0412:
    SAEMRSA15_08800 (sspA)
    JH1:
    SaurJH1_1130
    JH9:
    SaurJH9_1107
    JKD6008:
    SAA6008_01003
    JKD6159:
    SAA6159_00905
    LGA251:
    SARLGA251_09630 (sspA)
    M013:
    M013TW_0978
    MRSA252:
    SAR1022 (sspA)
    MSHR1132:
    SAMSHR1132_08970
    MSSA476:
    SAS0984
    Mu3:
    SAHV_1041 (sspA)
    Mu50:
    SAV1048 (sspA)
    MW2:
    MW0932 (sspA)
    RF122:
    SAB0915c (sspA)
    ST398:
    SAPIG1046
    T0131:
    SAT0131_01083
    TCH60:
    HMPREF0772_12186 (sspA)
    TW20:
    SATW20_10450 (sspA)
    USA300_TCH1516:
    USA300HOU_0996 (sspA)
    VC40:
    SAVC_04410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKP
    N315            MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIKKGGNLKP
    NCTC8325        MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKP
    Newman          MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKP
    USA300_FPR3757  MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKP
                    ****************************************************:*******

    COL             LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
    N315            LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
    NCTC8325        LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
    Newman          LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
    USA300_FPR3757  LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
                    ************************************************************

    COL             VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
    N315            VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
    NCTC8325        VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
    Newman          VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
    USA300_FPR3757  VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
                    ************************************************************

    COL             KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
    N315            KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
    NCTC8325        KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
    Newman          KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
    USA300_FPR3757  KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
                    ************************************************************

    COL             VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPD------N
    N315            VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNN
    NCTC8325        VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPD------N
    Newman          VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPD------N
    USA300_FPR3757  VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPD------N
                    *****************************************************      *

    COL             PDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDTNNSDNPDAA
    N315            PDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
    NCTC8325        PDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
    Newman          PDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
    USA300_FPR3757  PDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
                    ********************************.*********