From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003315000
  • symbol?: def
  • description?: peptide deformylase

      descriptions from strain specific annotations:

    • peptide deformylase
    • putative polypeptide deformylase 2
  • strand?: -
  • coordinates?: 3682725..3683276
  • synteny block?: BlockID0023990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1100 (def)
    N315:
    SA0942 (def)
    NCTC8325:
    Newman:
    NWMN_0957 (def)
    USA300_FPR3757:
    04-02981:
    SA2981_1048 (pdf1)
    08BA02176:
    C248_1118
    11819-97:
    MS7_1048
    71193:
    ST398NM01_1088
    ECT-R 2:
    ECTR2_946 (def)
    ED133:
    SAOV_1035c
    ED98:
    SAAV_1056 (def)
    HO 5096 0412:
    SAEMRSA15_09210
    JH1:
    SaurJH1_1173 (def)
    JH9:
    SaurJH9_1151 (def)
    JKD6008:
    SAA6008_01046 (def)
    JKD6159:
    SAA6159_00947 (def)
    LGA251:
    SARLGA251_10040
    M013:
    M013TW_1023
    MRSA252:
    SAR1065 (def)
    MSHR1132:
    SAMSHR1132_09380
    MSSA476:
    SAS1026 (def)
    Mu3:
    SAHV_1083 (def)
    Mu50:
    SAV1091 (def)
    MW2:
    MW0974 (def)
    RF122:
    SAB0957c (def)
    ST398:
    SAPIG1088 (def)
    T0131:
    SAT0131_01128
    TCH60:
    HMPREF0772_12141 (def2)
    TW20:
    SATW20_10860
    USA300_TCH1516:
    USA300HOU_1034 (def)
    VC40:
    SAVC_04615 (def)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
    N315            MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
    NCTC8325        MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
    Newman          MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
    USA300_FPR3757  MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
                    ************************************************************

    COL             LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
    N315            LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
    NCTC8325        LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
    Newman          LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
    USA300_FPR3757  LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
                    ************************************************************

    COL             LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKDHPLQPHTDA
    N315            LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA
    NCTC8325        LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKDHPLQPHTDA
    Newman          LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKDHPLQPHTDA
    USA300_FPR3757  LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKDHPLQPHTDA
                    **************************************************:*********

    COL             VEV
    N315            VEV
    NCTC8325        VEV
    Newman          VEV
    USA300_FPR3757  VEV
                    ***