From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01038
  • pan locus tag?: SAUPAN003315000
  • symbol: def
  • pan gene symbol?: def
  • synonym:
  • product: peptide deformylase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01038
  • symbol: def
  • product: peptide deformylase
  • replicon: chromosome
  • strand: -
  • coordinates: 1006694..1007245
  • length: 552
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGTTAACAATGAAAGACATCATTAGAGATGGTCATCCAACTTTGCGTCAAAAAGCAGCT
    GAGTTAGAATTACCATTAACTAAAGAAGAAAAAGAAACATTAATCGCCATGAGAGAGTTT
    TTAGTAAATAGTCAAGATGAGGAAATCGCGAAACGATATGGTTTACGTTCAGGCGTTGGT
    TTGGCTGCACCTCAAATTAATATTTCTAAACGTATGATTGCTGTTTTAATACCAGATGAT
    GGCAGTGGCAAATCTTATGACTATATGCTTGTGAACCCAAAAATTGTAAGTCATAGCGTT
    CAAGAAGCTTATTTACCAACTGGTGAAGGTTGCCTTAGTGTCGATGATAATGTTGCTGGT
    CTAGTTCACCGTCATAATAGAATTACAATTAAAGCCAAAGACATCGAAGGTAATGATATA
    CAATTACGACTAAAAGGATATCCAGCAATTGTTTTCCAACATGAAATTGACCATTTAAAT
    GGTGTAATGTTCTATGATCACATTGACAAAGATCACCCATTACAACCACATACAGATGCA
    GTAGAAGTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    552

Protein[edit source | edit]

Protein Data Bank: 3U7K
Protein Data Bank: 3U7L
Protein Data Bank: 3U7M
Protein Data Bank: 3U7N

General[edit source | edit]

  • locus tag: SAOUHSC_01038
  • symbol: Def
  • description: peptide deformylase
  • length: 183
  • theoretical pI: 6.02566
  • theoretical MW: 20559.4
  • GRAVY: -0.34153

Function[edit source | edit]

  • reaction:
    EC 3.5.1.88?  ExPASy
    Peptide deformylaseFormyl-L-methionyl peptide + H2O = formate + methionyl peptide
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repairpeptide deformylase (TIGR00079; EC 3.5.1.88; HMM-score: 151.8)
  • TheSEED:  
    CarbohydratesCentral carbohydrate metabolismDehydrogenase complexes Peptide deformylase (EC 3.5.1.88) 
    Protein MetabolismProtein biosynthesisTranslation termination factors bacterial Peptide deformylase (EC 3.5.1.88) 
    Bacterial RNA-metabolizing Zn-dependent hydrolases Peptide deformylase (EC 3.5.1.88) 
    Conserved gene cluster associated with Met-tRNA formyltransferase Peptide deformylase (EC 3.5.1.88) 
  • PFAM:
    no clan definedPep_deformylase; Polypeptide deformylase (PF01327; HMM-score: 148.9)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.126
    • Ymax_pos: 20
    • Cmax: 0.116
    • Cmax_pos: 20
    • Smax: 0.225
    • Smax_pos: 16
    • Smean: 0.128
    • D: 0.127
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKDHPLQPHTDAVEV

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 2.000 2.001 2.002 2.003 2.004 2.005 2.006 2.007 2.008 2.009 2.010 2.011 2.012 2.013 2.014 2.015 2.016 2.017 2.018 2.019 2.020 2.021 2.022 2.023 2.024 2.025 2.026 2.027 2.028 2.029 2.030 2.031 2.032 2.033 2.034 2.035 2.036 2.037 2.038 2.039 2.040 2.041 2.042 2.043 2.044 2.045 2.046 2.047 2.048 2.049 2.050 2.051 2.052 2.053 2.054 2.055 2.056 2.057 2.058 2.059 2.060 2.061 2.062 2.063 2.064 2.065 2.066 2.067 2.068 2.069 2.070 2.071 2.072 2.073 2.074 2.075 2.076 2.077 2.078 2.079 2.080 2.081 2.082 2.083 2.084 2.085 2.086 2.087 2.088 2.089 2.090 2.091 2.092 2.093 2.094 2.095 2.096 2.097 2.098 2.099 2.100 2.101 2.102 2.103 2.104 2.105 2.106 2.107 2.108 2.109 2.110 2.111 2.112 2.113 2.114 2.115 2.116 2.117 2.118 2.119 2.120 2.121 2.122 2.123 2.124 2.125 2.126 2.127 2.128 2.129 2.130 2.131 2.132 2.133 2.134 2.135 2.136 2.137 2.138 2.139 2.140 2.141 2.142 2.143 2.144 2.145 2.146 2.147 2.148 2.149 2.150 2.151 2.152 2.153

Relevant publications[edit source | edit]