From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003325000
  • symbol?: potC
  • description?: spermidine/putrescine ABC superfamily ATP binding cassette transporter, permease protein

      descriptions from strain specific annotations:

    • spermidine/putrescine ABC superfamily ATP binding cassette transporter, permease protein
    • ABC transporter permease
    • spermidine/putrescine ABC transporter
    • binding-protein-dependent transport systems inner membrane component
    • spermidine/putrescine ABC transporter permease
    • Spermidine Putrescine ABC transporter permease component potC
    • binding-protein-dependent transport system inner membrane component family protein
    • spermidine/putrescine ABC transporter permease protein
    • putative ABC transport system permease
    • binding-protein-dependent transport system inner membrane protein
    • binding--dependent transport system inner membrane component family protein
    • PotC
  • strand?: +
  • coordinates?: 3692388..3693206
  • synteny block?: BlockID0024090
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0952 (potC)
    NCTC8325:
    Newman:
    NWMN_0967 (potC)
    USA300_FPR3757:
    04-02981:
    SA2981_1058 (potC)
    08BA02176:
    C248_1128
    11819-97:
    MS7_1058
    71193:
    ST398NM01_1098
    ECT-R 2:
    ECTR2_956
    ED133:
    SAOV_1045
    ED98:
    SAAV_1066
    HO 5096 0412:
    SAEMRSA15_09310
    JH1:
    SaurJH1_1183
    JH9:
    SaurJH9_1161
    JKD6008:
    SAA6008_01056 (potC)
    JKD6159:
    SAA6159_00957 (potC)
    LGA251:
    SARLGA251_10140
    M013:
    M013TW_1033
    MRSA252:
    SAR1075
    MSHR1132:
    SAMSHR1132_09480
    MSSA476:
    SAS1036
    Mu3:
    SAHV_1093 (potC)
    Mu50:
    SAV1101 (potC)
    MW2:
    MW0984 (potC)
    RF122:
    SAB0967
    ST398:
    SAPIG1098
    T0131:
    SAT0131_01139
    TCH60:
    HMPREF0772_12131 (potC)
    TW20:
    SATW20_10960
    USA300_TCH1516:
    VC40:
    SAVC_04665

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKWYGKLYIGILLAILYIPIFFLMFYSFNSAGNMIHFEHFTLEHYQSLFQNDHLMSVIFN
    N315            MKWYGKLYIGILLAILYIPIFFLMFYSFNSAGNMIHFEHFTLEHYQSLFQNDHLMSVIFN
    NCTC8325        MKWYGKLYIGILLAILYIPIFFLMFYSFNSAGNMIHFEHFTLEHYQSLFQNDHLMSVIFN
    Newman          MKWYGKLYIGILLAILYIPIFFLMFYSFNSAGNMIHFEHFTLEHYQSLFQNDHLMSVIFN
    USA300_FPR3757  MKWYGKLYIGILLAILYIPIFFLMFYSFNSAGNMIHFEHFTLEHYQSLFQNDHLMSVIFN
                    ************************************************************

    COL             TIAVALLAASISTVIGTFGAIAIYYLRNKKFKVTLLTLNNVLMVSSDVVIGASFLIMFTT
    N315            TIAVALLAASISTVIGTFGAIAIYYLRNKKFKVTLLTLNNVLMVSSDVVIGASFLIMFTT
    NCTC8325        TIAVALLAASISTVIGTFGAIAIYYLRNKKFKVTLLTLNNVLMVSSDVVIGASFLIMFTT
    Newman          TIAVALLAASISTVIGTFGAIAIYYLRNKKFKVTLLTLNNVLMVSSDVVIGASFLIMFTT
    USA300_FPR3757  TIAVALLAASISTVIGTFGAIAIYYLRNKKFKVTLLTLNNVLMVSSDVVIGASFLIMFTT
                    ************************************************************

    COL             IGHFTGLGLGFWTVLISHIAFCIPIVVIIVLPQLYEMNNNMLNAARDLGATEPQLLSNII
    N315            IGHFTGLGLGFWTVLISHIAFCIPIVVIIVLPQLYEMNNNMLNAARDLGATEPQLLSNII
    NCTC8325        IGHFTGLGLGFWTVLISHIAFCIPIVVIIVLPQLYEMNNNMLNAARDLGATEPQLLSNII
    Newman          IGHFTGLGLGFWTVLISHIAFCIPIVVIIVLPQLYEMNNNMLNAARDLGATEPQLLSNII
    USA300_FPR3757  IGHFTGLGLGFWTVLISHIAFCIPIVVIIVLPQLYEMNNNMLNAARDLGATEPQLLSNII
                    ************************************************************

    COL             IPNILPSIIGGFFMALTYSLDDFTVSFFVTGNGFSVLSVEVYAMARKGISMEINAISTLL
    N315            IPNILPSIIGGFFMALTYSLDDFTVSFFVTGNGFSVLSVEVYAMARKGISMEINAISTLL
    NCTC8325        IPNILPSIIGGFFMALTYSLDDFTVSFFVTGNGFSVLSVEVYAMARKGISMEINAISTLL
    Newman          IPNILPSIIGGFFMALTYSLDDFTVSFFVTGNGFSVLSVEVYAMARKGISMEINAISTLL
    USA300_FPR3757  IPNILPSIIGGFFMALTYSLDDFTVSFFVTGNGFSVLSVEVYAMARKGISMEINAISTLL
                    ************************************************************

    COL             FAVIVLGILGYYLIQYVINKKKLIKRGVK
    N315            FAVIVLGILGYYLIQYVINKKKLIKRGVK
    NCTC8325        FAVIVLGILGYYLIQYVINKKKLIKRGVK
    Newman          FAVIVLGILGYYLIQYVINKKKLIKRGVK
    USA300_FPR3757  FAVIVLGILGYYLIQYVINKKKLIKRGVK
                    *****************************