Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003342000
  • symbol?: ctaA
  • description?: heme synthase

      descriptions from strain specific annotations:

    • heme synthase
    • cytochrome oxidase assembly
    • cytochrome oxidase assembly protein
    • Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA
    • cytochrome aa3-controlling protein
    • putative heme A synthase
    • heme O monooxygenase
    • heme O-oxygenase
  • strand?: -
  • coordinates?: 3710874..3711785
  • synteny block?: BlockID0024260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1124 (ctaA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1072 (ctaA)
    08BA02176:
    C248_1142 (ctaA)
    11819-97:
    MS7_1072 (ctaA)
    71193:
    ST398NM01_1112
    ECT-R 2:
    ECTR2_970
    ED133:
    SAOV_1057c
    ED98:
    SAAV_1081 (ctaA)
    HO 5096 0412:
    SAEMRSA15_09450 (ctaA)
    JH1:
    SaurJH1_1197
    JH9:
    SaurJH9_1175
    JKD6008:
    SAA6008_01070 (ctaA)
    JKD6159:
    SAA6159_00970 (ctaA)
    LGA251:
    SARLGA251_10280 (ctaA)
    M013:
    M013TW_1047
    MRSA252:
    SAR1089 (ctaA)
    MSHR1132:
    SAMSHR1132_09620
    MSSA476:
    SAS1050
    Mu3:
    SAHV_1107
    Mu50:
    SAV1115
    MW2:
    MW0998
    RF122:
    SAB0980c (ctaA)
    ST398:
    SAPIG1112
    T0131:
    SAT0131_01154
    TCH60:
    HMPREF0772_12117 (ctaA)
    TW20:
    SATW20_11100 (ctaA)
    USA300_TCH1516:
    USA300HOU_1053 (ctaA)
    VC40:
    SAVC_04740

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSSTYNTCKIKSYFLRWIPSFHILQSGLFIVSSQSRLLILILSDAFFYDGVYKLFGKKNL
    N315            -----------------------------------------------------MFGKKNL
    NCTC8325        MSSTYNTCKIKSYFLRWIPSFHILQSGLFIVSSQIRLLILILSDAFFYDGVYKLFGKKNL
    Newman          MSSTYNTCKIKSYFLRWIPSFHILQSGLFIVSSQIRLLILILSDAFFYDGVYKLFGKKNL
    USA300_FPR3757  MSSTYNTCKIKSYFLRWIPSFHILQSGLFIVSSQIRLLILILSDAFFYDGVYKLFGKKNL
                                                                         :******

    COL             KWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIELSHRAVS
    N315            KWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIELSHRAVS
    NCTC8325        KWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIELSHRAVS
    Newman          KWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIELSHRAVS
    USA300_FPR3757  KWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIELSHRAVS
                    ************************************************************

    COL             ALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDYVLALHFG
    N315            ALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDYVLALHFG
    NCTC8325        ALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDYVLALHFG
    Newman          ALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDYVLALHFG
    USA300_FPR3757  ALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDYVLALHFG
                    ************************************************************

    COL             ISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGALVRHADA
    N315            ISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGALVRHADA
    NCTC8325        ISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGALVRHADA
    Newman          ISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGALVRHADA
    USA300_FPR3757  ISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGALVRHADA
                    ************************************************************

    COL             SLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNRTVHYGYT
    N315            SLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNRTVHYGYT
    NCTC8325        SLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNRTVHYGYT
    Newman          SLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNRTVHYGYT
    USA300_FPR3757  SLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNRTVHYGYT
                    ************************************************************

    COL             AAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRSDKQ
    N315            AAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRSDKQ
    NCTC8325        AAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRSDKQ
    Newman          AAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRSDKQ
    USA300_FPR3757  AAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRSDKQ
                    ********************************************************