From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003387000
  • symbol?: sdhC
  • description?: succinate dehydrogenase cytochrome b-558

      descriptions from strain specific annotations:

    • succinate dehydrogenase cytochrome b-558
    • succinate dehydrogenase, cytochrome b558 subunit
    • succinate dehydrogenase cytochrome b-558 subunit
    • putative succinate dehydrogenase cytochromeb558
    • succinate dehydrogenase cytochrome b558 subunit (Cytochrome b-558)
    • succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family
    • succinate dehydrogenase, cytochrome b556 subunit
    • succinate dehydrogenase/fumarate reductase cytochrome b subunit
    • Succinate dehydrogenase subunit C
  • strand?: +
  • coordinates?: 3749267..3749881
  • synteny block?: BlockID0024700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1158 (sdhC)
    N315:
    SA0994 (sdhC)
    NCTC8325:
    Newman:
    NWMN_1060 (sdhC)
    USA300_FPR3757:
    04-02981:
    SA2981_1103 (sdhC)
    08BA02176:
    C248_1176 (sdhC)
    11819-97:
    MS7_1104 (sdhC)
    71193:
    ST398NM01_1143
    ECT-R 2:
    ECTR2_1001 (sdhC)
    ED133:
    SAOV_1144
    ED98:
    SAAV_1115 (sdhC)
    HO 5096 0412:
    SAEMRSA15_09770 (sdhC)
    JH1:
    SaurJH1_1228
    JH9:
    SaurJH9_1206
    JKD6008:
    SAA6008_01101 (sdhC)
    JKD6159:
    SAA6159_01001 (sdhC)
    LGA251:
    SARLGA251_10590 (sdhC)
    M013:
    M013TW_1080
    MRSA252:
    SAR1120 (sdhC)
    MSHR1132:
    SAMSHR1132_09930
    MSSA476:
    SAS1081
    Mu3:
    SAHV_1138 (sdhC)
    Mu50:
    SAV1147 (sdhC)
    MW2:
    MW1030 (sdhC)
    RF122:
    SAB1011 (sdhC)
    ST398:
    SAPIG1143
    T0131:
    SAT0131_01189 (cbiO)
    TCH60:
    HMPREF0772_12086 (sdhC)
    TW20:
    SATW20_11410 (sdhC)
    USA300_TCH1516:
    USA300HOU_1083 (sdhC)
    VC40:
    SAVC_04900

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAQSKNEFYLRRIHSLLGIIPIGAFLVVHLLVNHQATQGAEAFNKASNFMESLPFLIIVE
    N315            MAQSKNEFYLRRIHSLLGIIPIGAFLVVHLLVNHQATQGAEAFNKASNFMESLPFLIIVE
    NCTC8325        MAQSKNEFYLRRIHSLLGIIPIGAFLVVHLLVNHQATQGAEAFNKASNFMESLPFLIIVE
    Newman          MAQSKNEFYLRRIHSLLGIIPIGAFLVVHLLVNHQATQGAEAFNKASNFMESLPFLIIVE
    USA300_FPR3757  MAQSKNEFYLRRIHSLLGIIPIGAFLVVHLLVNHQATQGAEAFNKASNFMESLPFLIIVE
                    ************************************************************

    COL             FLFIYIPLLYHGLFGIHIAFTAKENVGHYSIFRNWMFFFQRVSGILTFIFIGIHLWQTRL
    N315            FLFIYIPLLYHGLFGIHIAFTAKENVGHYSIFRNWMFFFQRVSGILTFIFIGIHLWQTRL
    NCTC8325        FLFIYIPLLYHGLFGIHIAFTAKENVGHYSIFRNWMFFFQRVSGILTFIFIGIHLWQTRL
    Newman          FLFIYIPLLYHGLFGIHIAFTAKENVGHYSIFRNWMFFFQRVSGILTFIFIGIHLWQTRL
    USA300_FPR3757  FLFIYIPLLYHGLFGIHIAFTAKENVGHYSIFRNWMFFFQRVSGILTFIFIGIHLWQTRL
                    ************************************************************

    COL             QKAFYGKEVNYDLMHETLQHPGWAIFYIICIIAVVFHFANGLWSFLVTWGGLQSPKSQRV
    N315            QKAFYGKEVNYDLMHETLQHPGWAIFYIICIIAVVFHFANGLWSFLVTWGGLQSPKSQRV
    NCTC8325        QKAFYGKEVNYDLMHETLQHPGWAIFYIICIIAVVFHFANGLWSFLVTWGGLQSPKSQRV
    Newman          QKAFYGKEVNYDLMHETLQHPGWAIFYIICIIAVVFHFANGLWSFLVTWGGLQSPKSQRV
    USA300_FPR3757  QKAFYGKEVNYDLMHETLQHPGWAIFYIICIIAVVFHFANGLWSFLVTWGGLQSPKSQRV
                    ************************************************************

    COL             FTWVSLIVFLVISYIGVTAIIAFM
    N315            FTWVSLIVFLVISYIGVTAIIAFM
    NCTC8325        FTWVSLIVFLVISYIGVTAIIAFM
    Newman          FTWVSLIVFLVISYIGVTAIIAFM
    USA300_FPR3757  FTWVSLIVFLVISYIGVTAIIAFM
                    ************************