From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01103
  • pan locus tag?: SAUPAN003387000
  • symbol: SAOUHSC_01103
  • pan gene symbol?: sdhC
  • synonym:
  • product: succinate dehydrogenase cytochrome b-558 subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01103
  • symbol: SAOUHSC_01103
  • product: succinate dehydrogenase cytochrome b-558 subunit
  • replicon: chromosome
  • strand: +
  • coordinates: 1064670..1065284
  • length: 615
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    TTGGCTCAATCAAAAAATGAATTTTATCTAAGACGTATTCACTCGTTATTAGGTATTATC
    CCAATAGGTGCATTTTTGGTCGTTCATTTATTAGTGAATCACCAAGCAACACAAGGTGCT
    GAAGCGTTTAATAAGGCATCTAACTTTATGGAATCATTACCATTTCTAATTATTGTAGAA
    TTTTTATTTATATACATTCCGTTGTTATATCACGGTTTGTTTGGTATACACATTGCATTT
    ACAGCAAAAGAAAATGTTGGACATTACTCGATTTTTAGAAACTGGATGTTCTTCTTCCAA
    AGAGTGAGTGGTATCTTAACATTTATCTTTATTGGTATCCATTTATGGCAAACACGTTTA
    CAAAAAGCATTTTACGGCAAAGAAGTGAATTACGATTTAATGCACGAAACATTGCAACAT
    CCTGGATGGGCAATATTTTATATTATTTGTATTATTGCTGTTGTGTTCCACTTTGCAAAT
    GGCTTATGGTCATTCTTAGTTACTTGGGGTGGACTTCAATCTCCAAAATCACAACGAGTA
    TTTACATGGGTTTCATTAATCGTATTTTTAGTTATTTCGTATATTGGTGTTACTGCAATT
    ATTGCCTTTATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    615

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01103
  • symbol: SAOUHSC_01103
  • description: succinate dehydrogenase cytochrome b-558 subunit
  • length: 204
  • theoretical pI: 9.57454
  • theoretical MW: 23598.8
  • GRAVY: 0.720588

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismTCA cyclesuccinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family (TIGR02046; HMM-score: 143.1)
    MetabolismEnergy metabolismTCA cyclesuccinate dehydrogenase, cytochrome b556 subunit (TIGR02970; HMM-score: 53.4)
    MetabolismEnergy metabolismTCA cyclesuccinate dehydrogenase, hydrophobic membrane anchor protein (TIGR02968; HMM-score: 20.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingmembrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 10.9)
  • TheSEED:  
    RespirationElectron donating reactionsSuccinate dehydrogenase Succinate dehydrogenase cytochrome b558 subunit 
  • PFAM:
    FumRed-TM (CL0335) Sdh_cyt; Succinate dehydrogenase/Fumarate reductase transmembrane subunit (PF01127; HMM-score: 60.5)
    no clan definedDUF2177; Predicted membrane protein (DUF2177) (PF09945; HMM-score: 16.8)
    FumRed-TM (CL0335) DUF1691; Protein of unknown function (DUF1691) (PF07950; HMM-score: 10.7)
    Yip1 (CL0112) Yip1; Yip1 domain (PF04893; HMM-score: 8.9)
    no clan definedWTF; WTF protein (PF03303; HMM-score: 7.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.344
    • Ymax_pos: 43
    • Cmax: 0.283
    • Cmax_pos: 43
    • Smax: 0.681
    • Smax_pos: 34
    • Smean: 0.294
    • D: 0.324
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAQSKNEFYLRRIHSLLGIIPIGAFLVVHLLVNHQATQGAEAFNKASNFMESLPFLIIVEFLFIYIPLLYHGLFGIHIAFTAKENVGHYSIFRNWMFFFQRVSGILTFIFIGIHLWQTRLQKAFYGKEVNYDLMHETLQHPGWAIFYIICIIAVVFHFANGLWSFLVTWGGLQSPKSQRVFTWVSLIVFLVISYIGVTAIIAFM

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Rosmarie Gaupp, Steffen Schlag, Manuel Liebeke, Michael Lalk, Friedrich Götz
Advantage of upregulation of succinate dehydrogenase in Staphylococcus aureus biofilms.
J. Bacteriol.: 2010, 192(9);2385-94
[PubMed:20207757] [WorldCat.org] [DOI] (I p)