From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003449000
  • symbol?: mraW
  • description?: S-adenosyl-methyltransferase MraW

      descriptions from strain specific annotations:

    • S-adenosyl-methyltransferase MraW
    • MraW methylase family protein
    • 16S rRNA m(4)C1402 methyltransferase
    • Ribosomal RNA small subunit methyltransferase H
    • rRNA small subunit methyltransferase H
    • S-adenosyl-L-methionine-dependent methyltransferase mraW
  • strand?: +
  • coordinates?: 3792477..3793412
  • synteny block?: BlockID0025290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1192 (mraW)
    N315:
    SA1022 (mraW)
    NCTC8325:
    Newman:
    NWMN_1089 (mraW)
    USA300_FPR3757:
    04-02981:
    SA2981_1137 (mraW)
    08BA02176:
    C248_1208
    11819-97:
    MS7_1136 (mraW)
    71193:
    ST398NM01_1176
    ECT-R 2:
    ECTR2_1035 (mraW)
    ED133:
    SAOV_1180
    ED98:
    SAAV_1150 (mraW)
    HO 5096 0412:
    SAEMRSA15_10120
    JH1:
    SaurJH1_1263 (mraW)
    JH9:
    SaurJH9_1238 (mraW)
    JKD6008:
    SAA6008_01133 (mraW)
    JKD6159:
    SAA6159_01030 (mraW)
    LGA251:
    SARLGA251_10900
    M013:
    M013TW_1113
    MRSA252:
    SAR1155 (mraW)
    MSHR1132:
    SAMSHR1132_10210
    MSSA476:
    SAS1113 (mraW)
    Mu3:
    SAHV_1169 (mraW)
    Mu50:
    SAV1179 (mraW)
    MW2:
    MW1062 (mraW)
    RF122:
    SAB1043 (mraW)
    ST398:
    SAPIG1176 (mraW)
    T0131:
    SAT0131_01224 (rpsC)
    TCH60:
    HMPREF0772_12053 (mraW)
    TW20:
    SATW20_11730
    USA300_TCH1516:
    USA300HOU_1119 (mraW)
    VC40:
    SAVC_05060

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFHHISVMLNETIDYLNVKENGVYIDCTLGGAGHALYLLNQLNDDGRLIAIDQDQTAIDN
    N315            MFHHISVMLNETIDYLNVKENGVYIDCTLGGAGHALYLLNQLNDDGRLIAIDQDQTAIDN
    NCTC8325        -------MLNETIDYLNVKENGVYIDCTLGGAGHALYLLNQLNDDGRLIAIDQDQTAIDN
    Newman          MFHHISVMLNETIDYLNVKENGVYIDCTLGGAGHALYLLNQLNDDGRLIAIDQDQTAIDN
    USA300_FPR3757  -------MLNETIDYLNVKENGVYIDCTLGGAGHALYLLNQLNDDGRLIAIDQDQTAIDN
                           *****************************************************

    COL             AKEVLKDHLHRVTFVHSNFRELTQILKDLNIEKVDGIYYDLGVSSPQLDIPERGFSYHHD
    N315            AKEVLKDHLHKVTFVHSNFRELTQILKDLNIEKVDGIYYDLGVSSPQLDIPERGFSYHHD
    NCTC8325        AKEVLKDHLHKVTFVHSNFRELTQILKDLNIEKVDGIYYDLGVSSPQLDIPERGFSYHHD
    Newman          AKEVLKDHLHRVTFVHSNFRELTQILKDLNIEKVDGIYYDLGVSSPQLDIPERGFSYHHD
    USA300_FPR3757  AKEVLKDHLHKVTFVHSNFRELTQILKDLNIEKVDGIYYDLGVSSPQLDIPERGFSYHHD
                    **********:*************************************************

    COL             ATLDMRMDQTQELTAYEIVNNWSYEALVKIFYRYGEEKFSKQIARRIEAHREQQPITTTL
    N315            ATLDMRMDQTQELTAYEIVNNWSYEALVKIFYRYGEEKFSKQIARRIEAHREQQPITTTL
    NCTC8325        ATLDMRMDQTQELTAYEIVNNWSYEALVKIFYRYGEEKFSKQIARRIEAHREQQPITTTL
    Newman          ATLDMRMDQTQELTAYEIVNNWSYEALVKIFYRYGEEKFSKQIARRIEAHREQQPITTTL
    USA300_FPR3757  ATLDMRMDQTQELTAYEIVNNWSYEALVKIFYRYGEEKFSKQIARRIEAHREQQPITTTL
                    ************************************************************

    COL             ELVDIIKEGIPAKARRKGGHPAKRVFQALRIAVNDELSAFEDSIEQAIELVKVDGRISVI
    N315            ELVDIIKEGIPAKARRKGGHPAKRVFQALRIAVNDELSAFEDSIEQAIELVKVDGRISVI
    NCTC8325        ELVDIIKEGIPAKARRKGGHPAKRVFQALRIAVNDELSAFEDSIEQAIELVKVDGRISVI
    Newman          ELVDIIKEGIPAKARRKGGHPAKRVFQALRIAVNDELSAFEDSIEQAIELVKVDGRISVI
    USA300_FPR3757  ELVDIIKEGIPAKARRKGGHPAKRVFQALRIAVNDELSAFEDSIEQAIELVKVDGRISVI
                    ************************************************************

    COL             TFHSLEDRLCKQVFQEYEKGPEVPRGLPVIPEAYTPKLKRVNRKPITATEEDLDDNNRAR
    N315            TFHSLEDRLCKQVFQEYEKGPEVPRGLPVIPEAYTPKLKRVNRKPITATEEDLDDNNRAR
    NCTC8325        TFHSLEDRLCKQVFQEYEKGPEVPRGLPVIPEAYTPKLKRVNRKPITATEEDLDDNNRAR
    Newman          TFHSLEDRLCKQVFQEYEKGPEVPRGLPVIPEAYTPKLKRVNRKPITATEEDLDDNNRAR
    USA300_FPR3757  TFHSLEDRLCKQVFQEYEKGPEVPRGLPVIPEAYTPKLKRVNRKPITATEEDLDDNNRAR
                    ************************************************************

    COL             SAKLRVAEILK
    N315            SAKLRVAEILK
    NCTC8325        SAKLRVAEILK
    Newman          SAKLRVAEILK
    USA300_FPR3757  SAKLRVAEILK
                    ***********