From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01143
  • pan locus tag?: SAUPAN003449000
  • symbol: mraW
  • pan gene symbol?: mraW
  • synonym:
  • product: 16S rRNA (cytosine(1402)-N(4))-methyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01143
  • symbol: mraW
  • product: 16S rRNA (cytosine(1402)-N(4))-methyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1092564..1093478
  • length: 915
  • essential: no [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGTTAAACGAAACCATTGATTATTTAAATGTAAAAGAAAATGGTGTGTACATTGACTGT
    ACGCTAGGTGGAGCGGGACATGCCCTTTATTTACTAAATCAATTAAATGACGACGGAAGA
    TTAATAGCAATCGATCAAGACCAAACTGCAATTGATAATGCTAAAGAGGTATTAAAGGAT
    CATTTGCATAAGGTGACTTTTGTTCATAGCAACTTCCGTGAATTAACTCAAATATTAAAA
    GACTTAAACATTGAAAAAGTAGATGGAATTTATTACGACTTGGGTGTTTCAAGCCCACAA
    CTCGACATTCCAGAACGAGGATTCAGTTATCACCATGACGCAACATTAGACATGCGTATG
    GACCAAACACAAGAACTAACAGCATATGAAATTGTTAACAATTGGTCATATGAAGCGTTA
    GTGAAGATTTTTTATCGCTATGGCGAGGAGAAATTTTCAAAACAGATAGCTCGAAGAATC
    GAAGCACATCGCGAACAACAACCAATAACAACAACATTAGAATTAGTTGACATTATAAAA
    GAAGGTATTCCTGCAAAAGCAAGAAGAAAAGGCGGACATCCTGCAAAACGAGTATTTCAA
    GCACTACGAATTGCAGTAAACGATGAATTGTCAGCTTTTGAAGATTCAATAGAACAAGCG
    ATTGAATTAGTGAAAGTAGATGGCAGGATTTCGGTAATCACTTTCCATTCTTTAGAAGAT
    CGTTTATGTAAACAGGTGTTCCAAGAATATGAAAAAGGTCCAGAGGTACCAAGAGGATTA
    CCAGTTATACCAGAAGCATATACACCTAAGTTAAAGCGTGTTAATCGTAAACCGATTACC
    GCTACAGAAGAAGATTTAGATGACAATAACAGAGCACGAAGCGCGAAATTACGTGTAGCT
    GAAATACTTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    915

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01143
  • symbol: MraW
  • description: 16S rRNA (cytosine(1402)-N(4))-methyltransferase
  • length: 304
  • theoretical pI: 5.65665
  • theoretical MW: 34829.3
  • GRAVY: -0.483882

Function[edit source | edit]

  • reaction:
    EC 2.1.1.199?  ExPASy
    16S rRNA (cytosine1402-N4)-methyltransferaseS-adenosyl-L-methionine + cytosine1402 in 16S rRNA = S-adenosyl-L-homocysteine + N4-methylcytosine1402 in 16S rRNA
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modification16S rRNA (cytosine(1402)-N(4))-methyltransferase (TIGR00006; EC 2.1.1.199; HMM-score: 398.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinonedemethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 14.2)
  • TheSEED:  
    Bacterial Cell Division 16S rRNA (cytosine(1402)-N(4))-methyltransferase EC 2.1.1.199) 
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_5; MraW methylase family (PF01795; HMM-score: 443.3)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 31.8)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 21.7)
    rRNA_methylase; Putative rRNA methylase (PF06962; HMM-score: 21.2)
    Methyltransf_3; O-methyltransferase (PF01596; HMM-score: 18.7)
    Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 18.1)
    Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 16.3)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 15.2)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 14.7)
    GCD14; tRNA methyltransferase complex GCD14 subunit (PF08704; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.106
    • Ymax_pos: 51
    • Cmax: 0.11
    • Cmax_pos: 44
    • Smax: 0.168
    • Smax_pos: 23
    • Smean: 0.099
    • D: 0.103
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLNETIDYLNVKENGVYIDCTLGGAGHALYLLNQLNDDGRLIAIDQDQTAIDNAKEVLKDHLHKVTFVHSNFRELTQILKDLNIEKVDGIYYDLGVSSPQLDIPERGFSYHHDATLDMRMDQTQELTAYEIVNNWSYEALVKIFYRYGEEKFSKQIARRIEAHREQQPITTTLELVDIIKEGIPAKARRKGGHPAKRVFQALRIAVNDELSAFEDSIEQAIELVKVDGRISVITFHSLEDRLCKQVFQEYEKGPEVPRGLPVIPEAYTPKLKRVNRKPITATEEDLDDNNRARSAKLRVAEILK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

M J Pucci, J A Thanassi, L F Discotto, R E Kessler, T J Dougherty
Identification and characterization of cell wall-cell division gene clusters in pathogenic gram-positive cocci.
J. Bacteriol.: 1997, 179(17);5632-5
[PubMed:9287029] [WorldCat.org] (P p)
A Wada, H Watanabe
Penicillin-binding protein 1 of Staphylococcus aureus is essential for growth.
J. Bacteriol.: 1998, 180(10);2759-65
[PubMed:9573165] [WorldCat.org] (P p)