From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003482000
  • symbol?: carA
  • description?: carbamoyl-phosphate synthase small subunit

      descriptions from strain specific annotations:

    • carbamoyl-phosphate synthase small subunit
    • carbamoyl-phosphate synthase, small subunit
    • Carbamoyl-phosphate synthase small chain
    • carbamoyl-phosphate synthase pyrimidine-specific small chain (Carbamoyl-phosphate synthetase glutamine chain)
    • putative carbamoyl-phosphate synthase,pyrimidine-specific, small chain
  • strand?: +
  • coordinates?: 3821722..3822858
  • synteny block?: BlockID0025610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1214 (carA)
    N315:
    SA1045 (pyrAA)
    NCTC8325:
    Newman:
    NWMN_1113 (pyrAA)
    USA300_FPR3757:
    04-02981:
    SA2981_1160 (pyrAA)
    08BA02176:
    C248_1231 (pyrAA)
    11819-97:
    MS7_1159 (carA)
    71193:
    ST398NM01_1199
    ECT-R 2:
    ECTR2_1057 (carA)
    ED133:
    SAOV_1205
    ED98:
    SAAV_1173 (carA)
    HO 5096 0412:
    SAEMRSA15_10350 (pyrAA)
    JH1:
    SaurJH1_1286
    JH9:
    SaurJH9_1261
    JKD6008:
    SAA6008_01156 (pyrAA)
    JKD6159:
    SAA6159_01055 (pyrAA)
    LGA251:
    SARLGA251_11130 (pyrAA)
    M013:
    M013TW_1137
    MRSA252:
    SAR1178 (pyrAA)
    MSHR1132:
    SAMSHR1132_10430
    MSSA476:
    SAS1136
    Mu3:
    SAHV_1192 (pyrAA)
    Mu50:
    SAV1202 (pyrAA)
    MW2:
    MW1085 (pyrAA)
    RF122:
    SAB1066 (pyrAA)
    ST398:
    SAPIG1199 (carA)
    T0131:
    SAT0131_01250
    TCH60:
    HMPREF0772_12030 (carA)
    TW20:
    SATW20_11960 (pyrAA)
    USA300_TCH1516:
    USA300HOU_1140 (carA)
    VC40:
    SAVC_05175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQSKRYLVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLI
    N315            MQSKRYLVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLI
    NCTC8325        MQSKRYLVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLI
    Newman          MQSKRYLVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLI
    USA300_FPR3757  MQSKRYLVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLI
                    ************************************************************

    COL             GNYGINRDDFESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITR
    N315            GNYGINRDDFESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITR
    NCTC8325        GNYGINRDDFESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITR
    Newman          GNYGINRDDFESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITR
    USA300_FPR3757  GNYGINRDDFESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITR
                    ************************************************************

    COL             KIRQHGVLKAGFTDRKEDIDQLVKHLQQVELPKNEVEIVSTKTPYVSTGKDLSVVLVDFG
    N315            KIRQHGVLKAGFTDRKEDIDQLVKHLQQVELPKNEVEIVSTKTPYVSTGKDLSVVLVDFG
    NCTC8325        KIRQHGVLKAGFTDRKEDIDQLVKHLQQVELPKNEVEIVSTKTPYVSTGKDLSVVLVDFG
    Newman          KIRQHGVLKAGFTDRKEDIDQLVKHLQQVELPKNEVEIVSTKTPYVSTGKDLSVVLVDFG
    USA300_FPR3757  KIRQHGVLKAGFTDRKEDIDQLVKHLQQVELPKNEVEIVSTKTPYVSTGKDLSVVLVDFG
                    ************************************************************

    COL             KKQNIVRELNVRGCNVTVVPYTTTAEEILAMAPDGVMLSNGPGNPEVVECAIPMIQGILG
    N315            KKQNIVRELNVRGCNVTVVPYTTTAEEILAMAPDGVMLSNGPGNPEVVECAIPMIQGILG
    NCTC8325        KKQNIVRELNVRGCNVTVVPYTTTAEEILAMAPDGVMLSNGPGNPEVVECAIPMIQGILG
    Newman          KKQNIVRELNVRGCNVTVVPYTTTAEEILAMAPDGVMLSNGPGNPEVVECAIPMIQGILG
    USA300_FPR3757  KKQNIVRELNVRGCNVTVVPYTTTAEEILAMAPDGVMLSNGPGNPEVVECAIPMIQGILG
                    ************************************************************

    COL             KIPFFGICLGHQLFALSQGASSFKMKFGHRGANHPVKNLETGKVDITSQNHGYAIDIDSL
    N315            KIPFFGICLGHQLFALSQGASSFKMKFGHRGANHPVKNLETGKVDITSQNHGYAIDIDSL
    NCTC8325        KIPFFGICLGHQLFALSQGASSFKMKFGHRGANHPVKNLETGKVDITSQNHGYAIDIDSL
    Newman          KIPFFGICLGHQLFALSQGASSFKMKFGHRGANHPVKNLETGKVDITSQNHGYAIDIDSL
    USA300_FPR3757  KIPFFGICLGHQLFALSQGASSFKMKFGHRGANHPVKNLETGKVDITSQNHGYAIDIDSL
                    ************************************************************

    COL             KSTDLEVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEK
    N315            KSTDLEVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEK
    NCTC8325        KSTDLEVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEK
    Newman          KSTDLEVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEK
    USA300_FPR3757  KSTDLEVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEK
                    ************************************************************

    COL             ERHINA
    N315            ERHINA
    NCTC8325        ERHINA
    Newman          ERHINA
    USA300_FPR3757  ERHINA
                    ******