From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003483000
  • symbol?: carB
  • description?: carbamoyl phosphate synthase large subunit

      descriptions from strain specific annotations:

    • carbamoyl phosphate synthase large subunit
    • Carbamoyl-phosphate synthase large chain
    • carbamoyl-phosphate synthase pyrimidine-specific large chain (Carbamoyl-phosphate synthetase ammonia chain)
    • putative carbamoyl-phosphate synthase, pyrimidine-specific, large chain
    • carbamoyl-phosphate synthase small subunit
    • carbamoyl-phosphate synthase, large subunit
  • strand?: +
  • coordinates?: 3822851..3826024
  • synteny block?: BlockID0025620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1215 (carB)
    N315:
    SA1046 (carB)
    NCTC8325:
    Newman:
    NWMN_1114 (carB)
    USA300_FPR3757:
    04-02981:
    SA2981_1161 (pyrAB)
    08BA02176:
    C248_1232 (pyrAB)
    11819-97:
    MS7_1160 (carB)
    71193:
    ST398NM01_1200
    ECT-R 2:
    ECTR2_1058 (carB)
    ED133:
    SAOV_1206
    ED98:
    SAAV_1174 (carB)
    HO 5096 0412:
    SAEMRSA15_10360 (pyrAB)
    JH1:
    SaurJH1_1287 (carB)
    JH9:
    SaurJH9_1262 (carB)
    JKD6008:
    SAA6008_01157 (carB)
    JKD6159:
    SAA6159_01056 (carB)
    LGA251:
    SARLGA251_11140 (pyrAB)
    M013:
    M013TW_1138
    MRSA252:
    SAR1179 (carB)
    MSHR1132:
    SAMSHR1132_10440
    MSSA476:
    SAS1137 (carB)
    Mu3:
    SAHV_1193 (carB)
    Mu50:
    SAV1203 (carB)
    MW2:
    MW1086 (carB)
    RF122:
    SAB1067 (carB)
    ST398:
    SAPIG1200 (carB)
    T0131:
    SAT0131_01251 (sarV)
    TCH60:
    HMPREF0772_12029 (carB)
    TW20:
    SATW20_11970 (pyrAB)
    USA300_TCH1516:
    USA300HOU_1141 (carB)
    VC40:
    SAVC_05180 (carB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPKRNDIKTILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYRVILVNSNPATIMTDKEI
    N315            MPKRNDIKTILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYRVILVNSNPATIMTDKEI
    NCTC8325        MPKRNDIKTILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYRVILVNSNPATIMTDKEI
    Newman          MPKRNDIKTILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYRVILVNSNPATIMTDKEI
    USA300_FPR3757  MPKRNDIKTILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYRVILVNSNPATIMTDKEI
                    ************************************************************

    COL             ADKVYIEPLTHDFIARIIRKEQPDALLPTLGGQTGLNMAIQLHESGVLQDNNVQLLGTEL
    N315            ADKVYIEPLTHDFIARIIRKEQPDALLPTLGGQTGLNMAIQLHESGVLQDNNVQLLGTEL
    NCTC8325        ADKVYIEPLTHDFIARIIRKEQPDALLPTLGGQTGLNMAIQLHESGVLQDNNVQLLGTEL
    Newman          ADKVYIEPLTHDFIARIIRKEQPDALLPTLGGQTGLNMAIQLHESGVLQDNNVQLLGTEL
    USA300_FPR3757  ADKVYIEPLTHDFIARIIRKEQPDALLPTLGGQTGLNMAIQLHESGVLQDNNVQLLGTEL
                    ************************************************************

    COL             TSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQVGYPLIVRPAFTMGGTGGG
    N315            TSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQVGYPLIVRPAFTMGGTGGG
    NCTC8325        TSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQVGYPLIVRPAFTMGGTGGG
    Newman          TSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQVGYPLIVRPAFTMGGTGGG
    USA300_FPR3757  TSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFKFKEQVGYPLIVRPAFTMGGTGGG
                    ************************************************************

    COL             ICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVCNMENIDPV
    N315            ICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVCNMENIDPV
    NCTC8325        ICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVCNMENIDPV
    Newman          ICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVCNMENIDPV
    USA300_FPR3757  ICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNAIVVCNMENIDPV
                    ************************************************************

    COL             GIHTGDSIVVAPSQTLSDVEYQMLRDVSLKVIRALGIEGGCNVQLALDPHSFDYYIIEVN
    N315            GIHTGDSIVVAPSQTLSDVEYQMLRDVSLKVIRALGIEGGCNVQLALDPHSFDYYIIEVN
    NCTC8325        GIHTGDSIVVAPSQTLSDVEYQMLRDVSLKVIRALGIEGGCNVQLALDPHSFDYYIIEVN
    Newman          GIHTGDSIVVAPSQTLSDVEYQMLRDVSLKVIRALGIEGGCNVQLALDPHSFDYYIIEVN
    USA300_FPR3757  GIHTGDSIVVAPSQTLSDVEYQMLRDVSLKVIRALGIEGGCNVQLALDPHSFDYYIIEVN
                    ************************************************************

    COL             PRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMLNPITGTSYAAFEPTLDYVISKIPRF
    N315            PRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMLNPITGTSYAAFEPTLDYVISKIPRF
    NCTC8325        PRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMLNPITGTSYAAFEPTLDYVISKIPRF
    Newman          PRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMLNPITGTSYAAFEPTLDYVISKIPRF
    USA300_FPR3757  PRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMLNPITGTSYAAFEPTLDYVISKIPRF
                    ************************************************************

    COL             PFDKFEKGERELGTQMKATGEVMAIGRTYEESLLKAIRSLEYGVHHLGLPNGESFDLDYI
    N315            PFDKFEKGERELGTQMKATGEVMAIGRTYEESLLKAIRSLEYGVHHLGLPNGESFDLDYI
    NCTC8325        PFDKFEKGERELGTQMKATGEVMAIGRTYEESLLKAIRSLEYGVHHLGLPNGESFDLDYI
    Newman          PFDKFEKGERELGTQMKATGEVMAIGRTYEESLLKAIRSLEYGVHHLGLPNGESFDLDYI
    USA300_FPR3757  PFDKFEKGERELGTQMKATGEVMAIGRTYEESLLKAIRSLEYGVHHLGLPNGESFDLDYI
                    ************************************************************

    COL             KERISHQDDERLFFIGEAIRRGTTLEEIHNMTQIDYFFLHKFQNIIDIEHQLKEHQGDLE
    N315            KERISHQDDERLFFIGEAIRRGTTLEEIHNMTQIDYFFLHKFQNIIDIEHQLKEHQGDLE
    NCTC8325        KERISHQDDERLFFIGEAIRRGTTLEEIHNMTQIDYFFLHKFQNIIDIEHQLKEHQGDLE
    Newman          KERISHQDDERLFFIGEAIRRGTTLEEIHNMTQIDYFFLHKFQNIIDIEHQLKEHQGDLE
    USA300_FPR3757  KERISHQDDERLFFIGEAIRRGTTLEEIHNMTQIDYFFLHKFQNIIDIEHQLKEHQGDLE
                    ************************************************************

    COL             YLKYAKDYGFSDKTIAHRFNMTEEEVYQLRMENDIKPVYKMVDTCAAEFESSTPYYYGTY
    N315            YLKYAKDYGFSDKTIAHRFNMTEEEVYQLRMENDIKPVYKMVDTCAAEFESSTPYYYGTY
    NCTC8325        YLKYAKDYGFSDKTIAHRFNMTEEEVYQLRMENDIKPVYKMVDTCAAEFESSTPYYYGTY
    Newman          YLKYAKDYGFSDKTIAHRFNMTEEEVYQLRMENDIKPVYKMVDTCAAEFESSTPYYYGTY
    USA300_FPR3757  YLKYAKDYGFSDKTIAHRFNMTEEEVYQLRMENDIKPVYKMVDTCAAEFESSTPYYYGTY
                    ************************************************************

    COL             ETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHAVWAIQKAGYEAIIVNNNPETVST
    N315            ETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHAVWAIQKAGYEAIIVNNNPETVST
    NCTC8325        ETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHAVWAIQKAGYEAIIVNNNPETVST
    Newman          ETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHAVWAIQKAGYEAIIVNNNPETVST
    USA300_FPR3757  ETENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHAVWAIQKAGYEAIIVNNNPETVST
                    ************************************************************

    COL             DFSISDKLYFEPLTEEDVMNIINLEKPKGVVVQFGGQTAINLADKLAKHGVKILGTSLEN
    N315            DFSISDKLYFEPLTEEDVMNIINLEKPKGVVVQFGGQTAINLADKLAKHGVKILGTSLEN
    NCTC8325        DFSISDKLYFEPLTEEDVMNIINLEKPKGVVVQFGGQTAINLADKLAKHGVKILGTSLEN
    Newman          DFSISDKLYFEPLTEEDVMNIINLEKPKGVVVQFGGQTAINLADKLAKHGVKILGTSLEN
    USA300_FPR3757  DFSISDKLYFEPLTEEDVMNIINLEKPKGVVVQFGGQTAINLADKLAKHGVKILGTSLEN
                    ************************************************************

    COL             LNRAEDRKEFEALLRKINVPQPQGKTATSPEEALANAAEIGYPVVVRPSYVLGGRAMEIV
    N315            LNRAEDRKEFEALLRKINVPQPQGKSATSPEEALANAAEIGYPVVVRPSYVLGGRAMEIV
    NCTC8325        LNRAEDRKEFEALLRKINVPQPQGKTATSPEEALANAAEIGYPVVVRPSYVLGGRAMEIV
    Newman          LNRAEDRKEFEALLRKINVPQPQGKTATSPEEALANAAEIGYPVVVRPSYVLGGRAMEIV
    USA300_FPR3757  LNRAEDRKEFEALLRKINVPQPQGKTATSPEEALANAAEIGYPVVVRPSYVLGGRAMEIV
                    *************************:**********************************

    COL             DNDKELENYMTQAVKASPEHPVLVDRYLTGKEIEVDAICDGETVIIPGIMEHIERAGVHS
    N315            DNDKELENYMTQAVKASPEHPVLVDRYLTGKEIEVDAICDGETVIIPGIMEHIERAGVHS
    NCTC8325        DNDKELENYMTQAVKASPEHPVLVDRYLTGKEIEVDAICDGETVIIPGIMEHIERAGVHS
    Newman          DNDKELENYMTQAVKASPEHPVLVDRYLTGKEIEVDAICDGETVIIPGIMEHIERAGVHS
    USA300_FPR3757  DNDKELENYMTQAVKASPEHPVLVDRYLTGKEIEVDAICDGETVIIPGIMEHIERAGVHS
                    ************************************************************

    COL             GDSIAVYPPQTLTEDELATLEDYTIKLAKGLNIIGLINIQFVIAHDGVYVLEVNPRSSRT
    N315            GDSIAVYPPQTLTEDELATLEDYTIKLAKGLNIIGLINIQFVIAHDGVYVLEVNPRSSRT
    NCTC8325        GDSIAVYPPQTLTEDELATLEDYTIKLAKGLNIIGLINIQFVIAHDGVYVLEVNPRSSRT
    Newman          GDSIAVYPPQTLTEDELATLEDYTIKLAKGLNIIGLINIQFVIAHDGVYVLEVNPRSSRT
    USA300_FPR3757  GDSIAVYPPQTLTEDELATLEDYTIKLAKGLNIIGLINIQFVIAHDGVYVLEVNPRSSRT
                    ************************************************************

    COL             VPFLSKITDIPMAQLAMRAIIGEKLTDMGYQEGVQPYAEGVFVKAPVFSFNKLKNVDITL
    N315            VPFLSKITDIPMAQLAMRAIIGEKLTDMGYQEGVQPYAEGVFVKAPVFSFNKLKNVDITL
    NCTC8325        VPFLSKITDIPMAQLAMRAIIGEKLTDMGYQEGVQPYAEGVFVKAPVFSFNKLKNVDITL
    Newman          VPFLSKITDIPMAQLAMRAIIGEKLTDMGYQEGVQPYAEGVFVKAPVFSFNKLKNVDITL
    USA300_FPR3757  VPFLSKITDIPMAQLAMRAIIGEKLTDMGYQEGVQPYAEGVFVKAPVFSFNKLKNVDITL
                    ************************************************************

    COL             GPEMKSTGEVMGKDTTLEKALFKGLTGSGVEVKDHGTVLMTVSDKDKEEVVKLAQRLNEV
    N315            GPEMKSTGEVMGKDTTLEKALFKGLTGSGVEVKDHGTVLMTVSDKDKEEVVKLAQRLNEV
    NCTC8325        GPEMKSTGEVMGKDTTLEKALFKGLTGSGVEVKDHGTVLMTVSDKDKEEVVKLAQRLNEV
    Newman          GPEMKSTGEVMGKDTTLEKALFKGLTGSGVEVKDHGTVLMTVSDKDKEEVVKLAQRLNEV
    USA300_FPR3757  GPEMKSTGEVMGKDTTLEKALFKGLTGSGVEVKDHGTVLMTVSDKDKEEVVKLAQRLNEV
                    ************************************************************

    COL             GYKILATSGTANKLAEYDIPAEVVGKIGGENDLLTRIQNGDVQIVINTMTKGKEVERDGF
    N315            GYKILATSGTANKLAEYDIPAEVVGKIGGENDLLTRIQNGDVQIVINTMTKGKEVERDGF
    NCTC8325        GYKILATSGTANKLAEYDIPAEVVGKIGGENDLLTRIQNGDVQIVINTMTKGKEVERDGF
    Newman          GYKILATSGTANKLAEYDIPAEVVGKIGGENDLLTRIQNGDVQIVINTMTKGKEVERDGF
    USA300_FPR3757  GYKILATSGTANKLAEYDIPAEVVGKIGGENDLLTRIQNGDVQIVINTMTKGKEVERDGF
                    ************************************************************

    COL             QIRRTTVENGIPCLTSLDTANALTNVIESMTFTMRQM
    N315            QIRRTTVENGIPCLTSLDTANALTNVIESMTFTMRQM
    NCTC8325        QIRRTTVENGIPCLTSLDTANALTNVIESMTFTMRQM
    Newman          QIRRTTVENGIPCLTSLDTANALTNVIESMTFTMRQM
    USA300_FPR3757  QIRRTTVENGIPCLTSLDTANALTNVIESMTFTMRQM
                    *************************************