From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003509000
  • symbol?: fakA
  • description?: DAK2 domain-containing protein

      descriptions from strain specific annotations:

    • DAK2 domain-containing protein
    • Dihydroxyacetone kinase family protein
    • DAK2 domain protein
    • Dak phosphatase
  • strand?: +
  • coordinates?: 3848607..3850253
  • synteny block?: BlockID0025880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1184
    08BA02176:
    C248_1256
    11819-97:
    MS7_1184
    71193:
    ST398NM01_1225
    ECT-R 2:
    ECTR2_1082
    ED133:
    SAOV_1229
    ED98:
    SAAV_1198
    HO 5096 0412:
    SAEMRSA15_10590
    JH1:
    SaurJH1_1310
    JH9:
    SaurJH9_1285
    JKD6008:
    SAA6008_01181
    JKD6159:
    SAA6159_01079
    LGA251:
    SARLGA251_11370
    M013:
    M013TW_1164
    MRSA252:
    SAR1202
    MSHR1132:
    SAMSHR1132_10670
    MSSA476:
    SAS1160
    Mu3:
    SAHV_1216
    Mu50:
    SAV1226
    MW2:
    MW1109
    RF122:
    SAB1090
    ST398:
    SAPIG1225
    T0131:
    SAT0131_01275
    TCH60:
    HMPREF0772_12006
    TW20:
    SATW20_12200
    USA300_TCH1516:
    USA300HOU_1162
    VC40:
    SAVC_05295

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNL
    N315            MISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNL
    NCTC8325        MISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNL
    Newman          MISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNL
    USA300_FPR3757  MISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNL
                    ************************************************************

    COL             SKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETA
    N315            SKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETA
    NCTC8325        SKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETA
    Newman          SKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETA
    USA300_FPR3757  SKNIGELGKTFSKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETA
                    ************************************************************

    COL             YKAVMKPVEGTILTVAKDAAQAAIEKANNTEDCIELMEYIIVKANESLENTPNLLAVLKE
    N315            YKAVMKPVEGTILTVAKDAAQAAIEKANNTEDCIELMEYIIVKANESLENTPNLLAVLKE
    NCTC8325        YKAVMKPVEGTILTVAKDAAQAAIEKANNTEDCIELMEYIIVKANESLENTPNLLAVLKE
    Newman          YKAVMKPVEGTILTVAKDAAQAAIEKANNTEDCIELMEYIIVKANESLENTPNLLAVLKE
    USA300_FPR3757  YKAVMKPVEGTILTVAKDAAQAAIEKANNTEDCIELMEYIIVKANESLENTPNLLAVLKE
                    ************************************************************

    COL             VGVVDSGGKGLLCVYEGFLKALKGEKVEAKVAKIDKDEFVHDEHDFHGVINTEDIIYGYC
    N315            VGVVDSGGKGLLCVYEGFLKALKGEKVEAKVAKIDKDEFVHDEHDFHGVINTEDIIYGYC
    NCTC8325        VGVVDSGGKGLLCVYEGFLKALKGEKVEAKVAKIDKDEFVHDEHDFHGVINTEDIIYGYC
    Newman          VGVVDSGGKGLLCVYEGFLKALKGEKVEAKVAKIDKDEFVHDEHDFHGVINTEDIIYGYC
    USA300_FPR3757  VGVVDSGGKGLLCVYEGFLKALKGEKVEAKVAKIDKDEFVHDEHDFHGVINTEDIIYGYC
                    ************************************************************

    COL             TEMMVRFGKNKKAFDEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGE
    N315            TEMMVRFGKNKKAFDEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGE
    NCTC8325        TEMMVRFGKNKKAFDEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGE
    Newman          TEMMVRFGKNKKAFDEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGE
    USA300_FPR3757  TEMMVRFGKNKKAFDEQEFRQDMSQFGDSLLVINDEEIVKVHVHTEYPGKVFNYGQQYGE
                    ************************************************************

    COL             LIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEGISEIFKSMGATHIISGG
    N315            LIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEGISEIFKSMGATHIISGG
    NCTC8325        LIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEGISEIFKSMGATHIISGG
    Newman          LIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEGISEIFKSMGATHIISGG
    USA300_FPR3757  LIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEGISEIFKSMGATHIISGG
                    ************************************************************

    COL             QTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKSIPQGISA
    N315            QTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKSIPQGISA
    NCTC8325        QTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKSIPQGISA
    Newman          QTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKSIPQGISA
    USA300_FPR3757  QTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKSIPQGISA
                    ************************************************************

    COL             LFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQ
    N315            LFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQ
    NCTC8325        LFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQ
    Newman          LFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQ
    USA300_FPR3757  LFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQ
                    ************************************************************

    COL             SDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPI
    N315            SDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPI
    NCTC8325        SDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPI
    Newman          SDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPI
    USA300_FPR3757  SDQLTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPI
                    ************************************************************

    COL             YQYFFSVE
    N315            YQYFFSVE
    NCTC8325        YQYFFSVE
    Newman          YQYFFSVE
    USA300_FPR3757  YQYFFSVE
                    ********