From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003514000
  • symbol?: fabD
  • description?: malonyl CoA-ACP transacylase

      descriptions from strain specific annotations:

    • malonyl CoA-ACP transacylase
    • malonyl CoA-acyl carrier protein transacylase
    • putative malonyl CoA-acyl carrier proteintransacylase
    • malonyl-CoA-[acyl-carrier-protein] transacylase
  • strand?: +
  • coordinates?: 3854476..3855343
  • synteny block?: BlockID0025930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1244 (fabD)
    N315:
    SA1073 (fabD)
    NCTC8325:
    Newman:
    NWMN_1140 (fabD)
    USA300_FPR3757:
    04-02981:
    SA2981_1188 (fabD)
    08BA02176:
    C248_1260 (fabD)
    11819-97:
    MS7_1188 (fabD)
    71193:
    ST398NM01_1229
    ECT-R 2:
    ECTR2_1086 (fabD)
    ED133:
    SAOV_1233
    ED98:
    SAAV_1202 (fabD)
    HO 5096 0412:
    SAEMRSA15_10630 (fabD)
    JH1:
    SaurJH1_1314
    JH9:
    SaurJH9_1289
    JKD6008:
    SAA6008_01185 (fabD)
    JKD6159:
    SAA6159_01083 (fabD)
    LGA251:
    SARLGA251_11410 (fabD)
    M013:
    M013TW_1168
    MRSA252:
    SAR1206 (fabD)
    MSHR1132:
    SAMSHR1132_10710
    MSSA476:
    SAS1164
    Mu3:
    SAHV_1220 (fabD)
    Mu50:
    SAV1230 (fabD)
    MW2:
    MW1113 (fabD)
    RF122:
    SAB1094 (fabD)
    ST398:
    SAPIG1229 (fabD)
    T0131:
    SAT0131_01280 (ureE)
    TCH60:
    HMPREF0772_12002 (fabD)
    TW20:
    SATW20_12240 (fabD)
    USA300_TCH1516:
    USA300HOU_1166 (fabD)
    VC40:
    SAVC_05315

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKTAIIFPGQGAQKVGMAQDLFNNNDQATEILTSAANTLDFDILETMFTDEEGKLGETE
    N315            MSKTAIIFPGQGAQKVGMAQDLFNNNDQATEILTSAAKTLDFDILETMFTDEEGKLGETE
    NCTC8325        MSKTAIIFPGQGAQKVGMAQDLFNNNDQATEILTSAANTLDFDILETMFTDEEGKLGETE
    Newman          MSKTAIIFPGQGAQKVGMAQDLFNNNDQATEILTSAANTLDFDILETMFTDEEGKLGETE
    USA300_FPR3757  MSKTAIIFPGQGAQKVGMAQDLFNNNDQATEILTSAANTLDFDILETMFTDEEGKLGETE
                    *************************************:**********************

    COL             NTQPALLTHSSALLAALKNLNPDFTMGHSLGEYSSLVAADVLSFEDAVKIVRKRGQLMAQ
    N315            NTQPALLTHSSALLAALKNLNPDFTMGHSLGEYSSLVAADVLSFEDAVKIVRKRGQLMAQ
    NCTC8325        NTQPALLTHSSALLAALKNLNPDFTMGHSLGEYSSLVAADVLSFEDAVKIVRKRGQLMAQ
    Newman          NTQPALLTHSSALLAALKNLNPDFTMGHSLGEYSSLVAADVLSFEDAVKIVRKRGQLMAQ
    USA300_FPR3757  NTQPALLTHSSALLAALKNLNPDFTMGHSLGEYSSLVAADVLSFEDAVKIVRKRGQLMAQ
                    ************************************************************

    COL             AFPTGVGSMAAVLGLDFDKVDEICKSLSSDDKIIEPANINCPGQIVVSGHKALIDELVEK
    N315            AFPTGVGSMAAVLGLDFDKVDEICKSLSSDDKIIEPANINCPGQIVVSGHKALIDELVEK
    NCTC8325        AFPTGVGSMAAVLGLDFDKVDEICKSLSSDDKIIEPANINCPGQIVVSGHKALIDELVEK
    Newman          AFPTGVGSMAAVLGLDFDKVDEICKSLSSDDKIIEPANINCPGQIVVSGHKALIDELVEK
    USA300_FPR3757  AFPTGVGSMAAVLGLDFDKVDEICKSLSSDDKIIEPANINCPGQIVVSGHKALIDELVEK
                    ************************************************************

    COL             GKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEV
    N315            GKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEV
    NCTC8325        GKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEV
    Newman          GKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEV
    USA300_FPR3757  GKSLGAKRVMPLAVSGPFHSSLMKVIEEDFSSYINQFEWRDAKFPVVQNVNAQGETDKEV
                    ************************************************************

    COL             IKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSIQTLED
    N315            IKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSIQTLED
    NCTC8325        IKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSIQTLED
    Newman          IKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSIQTLED
    USA300_FPR3757  IKSNMVKQLYSPVQFINSTEWLIDQGVDHFIEIGPGKVLSGLIKKINRDVKLTSIQTLED
                    ************************************************************

    COL             VKGWNEND
    N315            VKGWNEND
    NCTC8325        VKGWNEND
    Newman          VKGWNEND
    USA300_FPR3757  VKGWNEND
                    ********