From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003545000
  • symbol?: dprA
  • description?: DNA processing protein

      descriptions from strain specific annotations:

    • DNA processing protein
    • Rossmann fold nucleotide-binding protein Smf
    • DNA protecting protein DprA
    • SMF family protein
    • DNA processing protein DprA
    • DNA recombination-mediator protein
    • DNA processing Smf protein
    • DNA processing protein DprA, putative
    • protein smf. domain protein
    • SMF family nucleotide-binding protein
    • pseudogene
  • strand?: +
  • coordinates?: 3881250..3882790
  • synteny block?: BlockID0026220
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_1280
    11819-97:
    MS7_1207 (dprA)
    71193:
    ST398NM01_1251
    ECT-R 2:
    ECTR2_1105
    ED133:
    SAOV_1251
    ED98:
    SAAV_1223
    HO 5096 0412:
    SAEMRSA15_10820
    JH1:
    SaurJH1_1333
    JH9:
    SaurJH9_1308
    JKD6008:
    SAA6008_01204
    JKD6159:
    SAA6159_01104
    LGA251:
    SARLGA251_11600
    M013:
    M013TW_1187
    MRSA252:
    SAR1225
    MSHR1132:
    SAMSHR1132_10920
    MSSA476:
    SAS1183
    Mu3:
    SAHV_1239
    Mu50:
    SAV1249
    MW2:
    MW1132
    RF122:
    SAB1111 (smf)
    ST398:
    SAPIG1251 (dprA)
    T0131:
    SAT0131_01300
    TCH60:
    HMPREF0772_11981 (dprA)
    TW20:
    SATW20_12430
    USA300_TCH1516:
    USA300HOU_1180
    VC40:
    SAVC_05410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKLFLLKLYWAHFSTKQIHQFLMAYPNVIKEEGRKKDSYLCEWVNREENVHLLRKYYAF
    N315            MIKLFLLKLYWAHFSTKQIHQFLMAYPNVIKEEGRKKDSYLCEWVNREENVLLLRKYYAF
    NCTC8325        --------------------------------------------MNREENVHLLRKYYAF
    Newman          MIKLFLLKLYWAHFSTKQIHQFLMAYPNVIKEEGRKKDSYLCEWVNREENVHLLRKYYAF
    USA300_FPR3757  MIKLFLLKLYWAHFSTKQIHQFLMAYPNVIKEEGRKKDSYLCEWVNREENVHLLRKYYAF
                                                                :****** ********

    COL             IKLDHNDIIKELQKLKVSYITYMDSEYPVLLKEIYQFPLLLFYKGNIKLINNMHHLAVVG
    N315            IKLDHNDIIKELQKLKVSYITYMDSEYPVLLKEIYQFPLLLFYKGNIKLINNMHHLAVVG
    NCTC8325        IKLDHNDIIKELQKLKVSYITYMDSEYPVLLKEIYQFPLLLFYKGNIKLINNMHHLAVVG
    Newman          IKLDHNDIIKELQKLKVSYITYMDSEYPVLLKEIYQFPLLLFYKGNIKLINNMHHLAVVG
    USA300_FPR3757  IKLDHNDIIKELQKLKVSYITYMDSEYPVLLKEIYQFPLLLFYKGNIKLINNMHHLAVVG
                    ************************************************************

    COL             ARDSTSYTQQSLEFLLSNDKSKYLTIVSGLAQGADAMAHQIALKYNLPTIAVLAFGHQTH
    N315            ARDSTSYTQQSLEFLLSNDKSKYLTIVSGLAQGADAMAHQIALKYNLPTIAVLAFGHQTH
    NCTC8325        ARDSTSYTQQSLEFLLSNDKSKYLTIVSGLAQGADAMAHQIALKYNLPTIAVLAFGHQTH
    Newman          ARDSTSYTQQSLEFLLSNDKSKYLTIVSGLAQGADAMAHQIALKYNLPTIAVLAFGHQTH
    USA300_FPR3757  ARDSTSYTQQSLEFLLSNDKSKYLTIVSGLAQGADAMAHQIALKYNLPTIAVLAFGHQTH
                    ************************************************************

    COL             YPKSTLALRNKIEEKGLVISEYPPHTPIAKYRFPERNRIISGLSKGVLITEAKEQSGSHI
    N315            YPKSTLALRNKIEEKGLVISEYPPHTPIAKYRFPERNRIISGLSKGVLITEAKEQSGSHI
    NCTC8325        YPKSTLALRNKIEEKGLVISEYPPHTPIAKYRFPERNRIISGLSKGVLITEAKEQSGSHI
    Newman          YPKSTLALRNKIEEKGLVISEYPPHTPIAKYRFPERNRIISGLSKGVLITEAKEQSGSHI
    USA300_FPR3757  YPKSTLALRNKIEEKGLVISEYPPHTPIAKYRFPERNRIISGLSKGVLITEAKEQSGSHI
                    ************************************************************

    COL             TIDFALEQNRNVYVLPGSMFNPMTKGNLLRIQEGAKVVLNANDIFEDYYI
    N315            TIDFALEQNRNVYVLPGSMFNPMTKGNLLRIQEGAKVVLNANDIFEDYYI
    NCTC8325        TIDFALEQNRNVYVLPGSMFNPMTKGNLLRIQEGAKVVLNANDIFEDYYI
    Newman          TIDFALEQNRNVYVLPGSMFNPMTKGNLLRIQEGAKVVLNANDIFEDYYI
    USA300_FPR3757  TIDFALEQNRNVYVLPGSMFNPMTKGNLLRIQEGAKVVLNANDIFEDYYI
                    **************************************************