From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01221
  • pan locus tag?: SAUPAN003545000
  • symbol: SAOUHSC_01221
  • pan gene symbol?: dprA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01221
  • symbol: SAOUHSC_01221
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1171904..1172644
  • length: 741
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGAATAGGGAAGAAAATGTTCATTTATTACGTAAATACTATGCTTTTATAAAACTTGAT
    CATAACGATATTATTAAAGAACTGCAGAAATTAAAAGTAAGTTACATTACATATATGGAT
    TCTGAATACCCAGTGCTATTAAAAGAAATATATCAATTTCCATTACTTCTTTTCTATAAA
    GGGAACATCAAATTAATAAATAATATGCATCATTTGGCAGTAGTAGGTGCAAGAGATTCT
    ACAAGTTATACCCAACAGTCTTTAGAATTTTTATTATCAAATGATAAAAGCAAATATTTA
    ACAATTGTTTCCGGCCTTGCTCAAGGAGCTGATGCAATGGCACATCAAATAGCTTTAAAA
    TACAATCTCCCTACAATTGCAGTTTTAGCCTTTGGCCATCAAACACATTATCCCAAAAGT
    ACATTAGCATTAAGAAATAAAATAGAAGAAAAAGGTTTAGTTATATCTGAATATCCACCA
    CATACACCAATCGCTAAATATAGATTTCCTGAGCGCAATAGAATTATCAGCGGTTTGTCA
    AAAGGGGTTTTAATTACTGAGGCTAAGGAACAAAGTGGCAGTCACATCACGATAGATTTT
    GCATTAGAGCAAAATAGAAATGTTTATGTTTTACCTGGATCTATGTTTAATCCTATGACA
    AAAGGTAATTTATTACGTATCCAAGAAGGTGCTAAGGTAGTATTAAACGCTAATGATATA
    TTTGAAGACTACTATATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    741

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01221
  • symbol: SAOUHSC_01221
  • description: hypothetical protein
  • length: 246
  • theoretical pI: 9.36378
  • theoretical MW: 28166.4
  • GRAVY: -0.20813

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesDNA transformationDNA protecting protein DprA (TIGR00732; HMM-score: 220.1)
  • TheSEED:  
    RNA MetabolismRNA processing and modificationYrdC-YciO-Sua5 and associated protein families Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake 
    Conserved gene cluster associated with Met-tRNA formyltransferase Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake 
  • PFAM:
    DprA (CL0349) DNA_processg_A; DNA recombination-mediator protein A (PF02481; HMM-score: 235.6)
    MoCo_carrier; Putative molybdenum carrier (PF12694; HMM-score: 19.5)
    no clan definedDUF2493; Protein of unknown function (DUF2493) (PF10686; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.108
    • Ymax_pos: 11
    • Cmax: 0.102
    • Cmax_pos: 28
    • Smax: 0.15
    • Smax_pos: 1
    • Smean: 0.112
    • D: 0.11
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNREENVHLLRKYYAFIKLDHNDIIKELQKLKVSYITYMDSEYPVLLKEIYQFPLLLFYKGNIKLINNMHHLAVVGARDSTSYTQQSLEFLLSNDKSKYLTIVSGLAQGADAMAHQIALKYNLPTIAVLAFGHQTHYPKSTLALRNKIEEKGLVISEYPPHTPIAKYRFPERNRIISGLSKGVLITEAKEQSGSHITIDFALEQNRNVYVLPGSMFNPMTKGNLLRIQEGAKVVLNANDIFEDYYI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]