From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003566000
  • symbol?: rimP
  • description?: clustered with transcription termination protein NusA

      descriptions from strain specific annotations:

    • clustered with transcription termination protein NusA
    • ribosome maturation protein RimP
    • protein LMOf2365_1338
    • Ribosome maturation factor rimP
  • strand?: +
  • coordinates?: 3904324..3904812
  • synteny block?: BlockID0026430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1223
    08BA02176:
    C248_1298
    11819-97:
    MS7_1223 (rimP)
    71193:
    ST398NM01_1267
    ECT-R 2:
    ECTR2_1121
    ED133:
    SAOV_1267
    ED98:
    SAAV_1240
    HO 5096 0412:
    SAEMRSA15_10980
    JH1:
    SaurJH1_1351
    JH9:
    SaurJH9_1325
    JKD6008:
    SAA6008_01220
    JKD6159:
    SAA6159_01120
    LGA251:
    SARLGA251_11760
    M013:
    M013TW_1205
    MRSA252:
    SAR1241
    MSHR1132:
    SAMSHR1132_11080
    MSSA476:
    SAS1199
    Mu3:
    SAHV_1255
    Mu50:
    SAV1265
    MW2:
    MW1148
    RF122:
    SAB1127
    ST398:
    SAPIG1267
    T0131:
    SAT0131_01318
    TCH60:
    HMPREF0772_11964
    TW20:
    SATW20_12590
    USA300_TCH1516:
    USA300HOU_1197
    VC40:
    SAVC_05490

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKITEQVEVIVKPIMEDLNFELVDVEYVKEGRDHFLRISIDKEGGVDLNDCTLASEKIS
    N315            MSKITEQVEVIVQPIMEDLNFELVDVEYVKEGRDHFLRISIDKEGGVDLNDCTLASEKIS
    NCTC8325        MSKITEQVEVIVKPIMEDLNFELVDVEYVKEGRDHFLRISIDKEGGVDLNDCTLASEKIS
    Newman          MSKITEQVEVIVKPIMEDLNFELVDVEYVKEGRDHFLRISIDKEGGVDLNDCTLASEKIS
    USA300_FPR3757  MSKITEQVEVIVKPIMEDLNFELVDVEYVKEGRDHFLRISIDKEGGVDLNDCTLASEKIS
                    ************:***********************************************

    COL             EAMDANDPIPEMYYLDVASPGAERPIKKEQDFQNAITKPVFVSLYVPIEGEKEWLGILQE
    N315            EAMDANDPIPEMYYLDVASPGAERPIKKEQDFQNAITKPVFVSLYVPIEGEKEWLGILQE
    NCTC8325        EAMDANDPIPEMYYLDVASPGAERPIKKEQDFQNAITKPVFVSLYVPIEGEKEWLGILQE
    Newman          EAMDANDPIPEMYYLDVASPGAERPIKKEQDFQNAITKPVFVSLYVPIEGEKEWLGILQE
    USA300_FPR3757  EAMDANDPIPEMYYLDVASPGAERPIKKEQDFQNAITKPVFVSLYVPIEGEKEWLGILQE
                    ************************************************************

    COL             VNNETIVVQVKIKARTKDIEIPRDKIAKARHAVMI
    N315            VNNETIVVQVKIKARTKDIEIPRDKIAKARHAVMI
    NCTC8325        VNNETIVVQVKIKARTKDIEIPRDKIAKARHAVMI
    Newman          VNNETIVVQVKIKARTKDIEIPRDKIAKARHAVMI
    USA300_FPR3757  VNNETIVVQVKIKARTKDIEIPRDKIAKARHAVMI
                    ***********************************