From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003613000
  • symbol?: glpD
  • description?: aerobic glycerol-3-phosphate dehydrogenase

      descriptions from strain specific annotations:

    • aerobic glycerol-3-phosphate dehydrogenase
    • glycerol-3-phosphate dehydrogenase/oxidase
    • DNA-directed DNA polymerase III subunit gamma and tau
  • strand?: +
  • coordinates?: 3954076..3955804
  • synteny block?: BlockID0026840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1321 (glpD)
    N315:
    SA1142 (glpD)
    NCTC8325:
    Newman:
    NWMN_1209 (glpD)
    USA300_FPR3757:
    04-02981:
    SA2981_1258 (glpD)
    08BA02176:
    C248_1335 (glpD)
    11819-97:
    MS7_1258 (glpD)
    71193:
    ST398NM01_1303
    ECT-R 2:
    ECTR2_1158
    ED133:
    SAOV_1302
    ED98:
    SAAV_1275 (glpD)
    HO 5096 0412:
    SAEMRSA15_11350 (glpD)
    JH1:
    SaurJH1_1386
    JH9:
    SaurJH9_1360
    JKD6008:
    SAA6008_01255 (glpD)
    JKD6159:
    SAA6159_01155 (glpD)
    LGA251:
    SARLGA251_12110 (glpD)
    M013:
    M013TW_1242
    MRSA252:
    SAR1276 (glpD)
    MSHR1132:
    SAMSHR1132_11430
    MSSA476:
    SAS1234
    Mu3:
    SAHV_1291 (glpD)
    Mu50:
    SAV1302 (glpD)
    MW2:
    MW1184 (glpD)
    RF122:
    SAB1162 (glpD)
    ST398:
    SAPIG1303
    T0131:
    SAT0131_01356 (tcaA)
    TCH60:
    HMPREF0772_11926 (glpD)
    TW20:
    SATW20_12940 (glpD)
    USA300_TCH1516:
    USA300HOU_1232 (glpD)
    VC40:
    SAVC_05700

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------------MALSTFKREHIKKNLRNDEYDLVIIGGGITGAGIALDASERGMK
    N315            MWDKSLVFTFFRRRFGMALSTFKREHIKKNLRNDEYDLVIIGGGITGAGIALDASERGMK
    NCTC8325        ----------------MALSTFKREHIKKNLRNDEYDLVIIGGGITGAGIALDASERGMK
    Newman          MWDKSLVFTFFRRRFGMALSTFKREHIKKNLRNDEYDLVIIGGGITGAGIALDASERGMK
    USA300_FPR3757  ----------------MALSTFKREHIKKNLRNDEYDLVIIGGGITGAGIALDASERGMK
                                    ********************************************

    COL             VALVEMQDFAQGTSSRSTKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWML
    N315            VALVEMQDFAQGTSSRSTKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWML
    NCTC8325        VALVEMQDFAQGTSSRSTKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWML
    Newman          VALVEMQDFAQGTSSRSTKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWML
    USA300_FPR3757  VALVEMQDFAQGTSSRSTKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWML
                    ************************************************************

    COL             LPMHKGGTFGKFSTSIGLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYV
    N315            LPMHKGGTFGKFSTSIGLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYV
    NCTC8325        LPMHKGGTFGKFSTSIGLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYV
    Newman          LPMHKGGTFGKFSTSIGLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYV
    USA300_FPR3757  LPMHKGGTFGKFSTSIGLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYV
                    ************************************************************

    COL             EYRTDDARLTIEVMKRAAEKGAEIINYTKSEHFTYDKNQQVNGVKVIDKLTNENYTIKAK
    N315            EYRTDDARLTIEVMKRAAEKGAEIINYTKSEHFTYDKNQQVNGVKVIDKLTNENYTIKAK
    NCTC8325        EYRTDDARLTIEVMKRAAEKGAEIINYTKSEHFTYDKNQQVNGVKVIDKLTNENYTIKAK
    Newman          EYRTDDARLTIEVMKRAAEKGAEIINYTKSEHFTYDKNQQVNGVKVIDKLTNENYTIKAK
    USA300_FPR3757  EYRTDDARLTIEVMKRAAEKGAEIINYTKSEHFTYDKNQQVNGVKVIDKLTNENYTIKAK
                    ************************************************************

    COL             KVVNAAGPWVDDVRSGDYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAI
    N315            KVVNAAGPWVDDVRSGDYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAI
    NCTC8325        KVVNAAGPWVDDVRSGDYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAI
    Newman          KVVNAAGPWVDDVRSGDYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAI
    USA300_FPR3757  KVVNAAGPWVDDVRSGDYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAI
                    ************************************************************

    COL             PREGKAYVGTTDTFYDNIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPL
    N315            PREGKAYVGTTDTFYDNIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPL
    NCTC8325        PREGKAYVGTTDTFYDNIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPL
    Newman          PREGKVYVGTTDTFYDNIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPL
    USA300_FPR3757  PREGKAYVGTTDTFYDNIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPL
                    *****.******************************************************

    COL             IYEEGKDPSEISRKDEIWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSP
    N315            IYEEGKDPSEISRKDEIWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSP
    NCTC8325        IYEEGKDPSEISRKDEIWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSP
    Newman          IYEEGKDPSEISRKDEIWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSP
    USA300_FPR3757  IYEEGKDPSEISRKDEIWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSP
                    ************************************************************

    COL             CNTKGLAISGGDVGGSKNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQT
    N315            CNTKGLAISGGDVGGSKNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQT
    NCTC8325        CNTKGLAISGGDVGGSKNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQT
    Newman          CNTKGLAISGGDVGGSKNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQT
    USA300_FPR3757  CNTKGLAISGGDVGGSKNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQT
                    ************************************************************

    COL             SQYHDSKLPLEIYVELVYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDAVIDIMADM
    N315            SQYHDSKLPLEIYVELVYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDAVIDIMADM
    NCTC8325        SQYHDSKLPLEIYVELVYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDAVIDIMADM
    Newman          SQYHDSKLPLEIYVELVYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDAVIDIMADM
    USA300_FPR3757  SQYHDSKLPLEIYVELVYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDAVIDIMADM
                    ************************************************************

    COL             LDYSPAQIEAYTEEVEQAIKEAQHGNNQPAVKE
    N315            LDYSPAQIEAYTEEVEQAIKEAQHGNNQPAVKE
    NCTC8325        LDYSPAQIEAYTEEVEQAIKEAQHGNNQPAVKE
    Newman          LDYSPAQIEAYTEEVEQAIKEAQHGNNQPAVKE
    USA300_FPR3757  LDYSPAQIEAYTEEVEQAIKEAQHGNNQPAVKE
                    *********************************