From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003688000
  • symbol?:
  • description?: multidrug ABC transporter permease

      descriptions from strain specific annotations:

    • multidrug ABC transporter permease
    • ABC transporter permease
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter
    • ABC transporter ATP-binding protein
    • ABC transporter permease protein
  • strand?: +
  • coordinates?: 3994104..3995844
  • synteny block?: BlockID0027540
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1275
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_1179
    ED133:
    ED98:
    SAAV_1299
    HO 5096 0412:
    SAEMRSA15_11670
    JH1:
    SaurJH1_1408
    JH9:
    SaurJH9_1381
    JKD6008:
    SAA6008_01284
    JKD6159:
    SAA6159_01187
    LGA251:
    M013:
    MRSA252:
    SAR1330
    MSHR1132:
    SAMSHR1132_11650
    MSSA476:
    SAS1260
    Mu3:
    SAHV_1309
    Mu50:
    SAV1320
    MW2:
    MW1207
    RF122:
    ST398:
    T0131:
    SAT0131_01387
    TCH60:
    HMPREF0772_11888
    TW20:
    SATW20_13220
    USA300_TCH1516:
    USA300HOU_1264
    VC40:
    SAVC_05840

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILSYLKIEFKVIMRKKTTLILSILFPVIFYILFTSILELPEDVKPKFYKEYMYSMTVYS
    N315            MILSYLKIEFKVIMRKKTTLILSILFPVIFYILFTSILELPEDVKPKFYKEYMYSMTVYS
    NCTC8325        MILSYLKIEFKVIMRKKTTLILSILFPVIFYILFTSILELPEDVKPKFYKEYMYSMTVYS
    Newman          MILSYLKIEFKVIMRKKTTLILSILFPVIFYILFTSILELPEDVKPKFYKEYMYSMTVYS
    USA300_FPR3757  MILSYLKIEFKVIMRKKTTLILSILFPVIFYILFTSILELPEDVKPKFYKEYMYSMTVYS
                    ************************************************************

    COL             LLSFSLLTFPLDIINEKQNEWRQRLMVTPFTFTSYYISKVVKTMLQFAIAILVIFMVGHF
    N315            LLSFSLLTFPLDIINEKQNEWRQRLMVTPFTFTSYYISKVVKTMLQFAIAILVIFMVGHF
    NCTC8325        LLSFSLLTFPLDIINEKQNEWRQRLMVTPFTFTSYYISKVVKTMLQFAIAILVIFMVGHF
    Newman          LLSFSLLTFPLDIINEKQNEWRQRLMVTPFTFTSYYISKVVKTMLQFAIAILVIFMVGHF
    USA300_FPR3757  LLSFSLLTFPLDIINEKQNEWRQRLMVTPFTFTSYYISKVVKTMLQFAIAILVIFMVGHF
                    ************************************************************

    COL             YKGVAMSAVQWLESGIFLWLGASLLITFGILFSLLNDIQKTSALANIVTIGLAVLGGLWF
    N315            YKGVAMSAVQWLESGIFLWLGASLLITFGILFSLLNDIQKTSALANIVTIGLAVLGGLWF
    NCTC8325        YKGVAMSAVQWLESGIFLWLGASLLITFGILFSLLNDIQKTSALANIVTIGLAVLGGLWF
    Newman          YKGVAMSAVQWLESGIFLWLGASLLITFGILFSLLNDIQKTSALANIVTIGLAVLGGLWF
    USA300_FPR3757  YKGVAMSAVQWLESGIFLWLGASLLITFGILFSLLNDIQKTSALANIVTIGLAVLGGLWF
                    ************************************************************

    COL             PINTFPNWLQHVAHVLPSYHLRKLGVDIASNHHINLISFAIILLYALGSIIAVYCISHFK
    N315            PINTFPNWLQHVAHVLPSYHLRKLGVDIASNHHINLISFAIILLYVLGSIIAVYCISHFK
    NCTC8325        PINTFPNWLQHVAHVLPSYHLRKLGVDIASNHHINLISFAIILLYALGSIIAVYCISHFK
    Newman          PINTFPNWLQHVAHVLPSYHLRKLGVDIASNHHINLISFAIILLYALGSIIAVYCISHFK
    USA300_FPR3757  PINTFPNWLQHVAHVLPSYHLRKLGVDIASNHHINLISFAIILLYALGSIIAVYCISHFK
                    *********************************************.**************

    COL             RAE
    N315            RAE
    NCTC8325        RAE
    Newman          RAE
    USA300_FPR3757  RAE
                    ***