From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003698000
  • symbol?: thrD
  • description?: aspartate kinase

      descriptions from strain specific annotations:

    • aspartate kinase
    • Aspartokinase
    • aspartate kinase domain protein
    • putative aspartate kinase
  • strand?: -
  • coordinates?: 4002776..4004158
  • synteny block?: BlockID0027640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1239 (thrA)
    USA300_FPR3757:
    04-02981:
    SA2981_1282
    08BA02176:
    C248_1361
    11819-97:
    MS7_1286
    71193:
    ST398NM01_1329
    ECT-R 2:
    ECTR2_1186
    ED133:
    SAOV_1340c
    ED98:
    SAAV_1306
    HO 5096 0412:
    SAEMRSA15_11740
    JH1:
    SaurJH1_1415
    JH9:
    SaurJH9_1388
    JKD6008:
    SAA6008_01292 (thrA)
    JKD6159:
    SAA6159_01194 (thrA)
    LGA251:
    SARLGA251_12360
    M013:
    M013TW_1275
    MRSA252:
    SAR1337
    MSHR1132:
    SAMSHR1132_11720
    MSSA476:
    SAS1267
    Mu3:
    SAHV_1316
    Mu50:
    SAV1327
    MW2:
    MW1214
    RF122:
    SAB1185c
    ST398:
    SAPIG1329
    T0131:
    SAT0131_01396
    TCH60:
    HMPREF0772_11881 (lysC2)
    TW20:
    SATW20_13290
    USA300_TCH1516:
    USA300HOU_1271 (lysC1)
    VC40:
    SAVC_05875

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLY
    N315            ----MKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLY
    NCTC8325        ----MKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLY
    Newman          MACTMKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLY
    USA300_FPR3757  ----MKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLY
                        ********************************************************

    COL             EKVINHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALL
    N315            EKVINHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALL
    NCTC8325        EKVINHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALL
    Newman          EKVINHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALL
    USA300_FPR3757  EKVINHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALL
                    ************************************************************

    COL             SCGEDFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEK
    N315            SCGEDFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEK
    NCTC8325        SCGEDFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEK
    Newman          SCGEDFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEK
    USA300_FPR3757  SCGEDFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEK
                    ************************************************************

    COL             LIIPGFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPE
    N315            LIIPGFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPE
    NCTC8325        LIIPGFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPE
    Newman          LIIPGFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPE
    USA300_FPR3757  LIIPGFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPE
                    ************************************************************

    COL             LIEEITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAK
    N315            LIEEITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAK
    NCTC8325        LIEEITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAK
    Newman          LIEEITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAK
    USA300_FPR3757  LIEEITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAK
                    ************************************************************

    COL             NVISGISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSK
    N315            NVISGISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSK
    NCTC8325        NVISGISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSK
    Newman          NVISGISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSK
    USA300_FPR3757  NVISGISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSK
                    ************************************************************

    COL             QIQNKETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLK
    N315            QIQNKETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLK
    NCTC8325        QIQNKETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLK
    Newman          QIQNKETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLK
    USA300_FPR3757  QIQNKETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLK
                    ************************************************************

    COL             MINQGASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN
    N315            MINQGASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN
    NCTC8325        MINQGASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN
    Newman          MINQGASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN
    USA300_FPR3757  MINQGASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN
                    ********************************************