From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003763000
  • symbol?: trpG
  • description?: anthranilate synthase component II

      descriptions from strain specific annotations:

    • anthranilate synthase component II
    • Anthranilate synthase, amidotransferase component
    • anthranilate synthase component II (Glutamine amido-transferase)
    • anthranilate synthase, glutamine amidotransferase, component II
    • glutamine amidotransferase of anthranilate synthase/aminodeoxychorismate synthase family protein
    • para-aminobenzoate/anthranilate synthase glutamine amidotransferasecomponent II
    • Para-aminobenzoate synthase glutamine amidotransferase component II
  • strand?: +
  • coordinates?: 4061204..4061770
  • synteny block?: BlockID0028250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1404 (trpG)
    N315:
    SA1200 (trpG)
    NCTC8325:
    Newman:
    NWMN_1280 (trpG)
    USA300_FPR3757:
    04-02981:
    SA2981_1322 (trpG)
    08BA02176:
    C248_1406 (trpG)
    11819-97:
    MS7_1325
    71193:
    ST398NM01_1369
    ECT-R 2:
    ECTR2_1225
    ED133:
    SAOV_1378
    ED98:
    SAAV_1350 (trpG)
    HO 5096 0412:
    SAEMRSA15_12160 (trpG)
    JH1:
    SaurJH1_1458
    JH9:
    SaurJH9_1429
    JKD6008:
    SAA6008_01333 (trpG)
    JKD6159:
    SAA6159_01234 (trpG)
    LGA251:
    SARLGA251_12770 (trpG)
    M013:
    M013TW_1314
    MRSA252:
    SAR1381 (trpG)
    MSHR1132:
    SAMSHR1132_12110
    MSSA476:
    SAS1308
    Mu3:
    SAHV_1356 (trpG)
    Mu50:
    SAV1368 (trpG)
    MW2:
    MW1255 (trpG)
    RF122:
    SAB1223 (trpG)
    ST398:
    SAPIG1369
    T0131:
    SAT0131_01440
    TCH60:
    HMPREF0772_11839 (trpG)
    TW20:
    SATW20_13680 (trpG)
    USA300_TCH1516:
    USA300HOU_1303 (trpG)
    VC40:
    SAVC_06090

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILVVDNYDSFTYNLVDIVAQHTDVIVQYPDDDNVLNQSVDAVIISPGPGHPLDDQQLMK
    N315            MILVVDNYDSFTYNLVDIVAQHTDVIVQYPDDDNVLNQSVDAVIISPGPGHPLDDQQLMK
    NCTC8325        MILVVDNYDSFTYNLVDIVAQHTDVIVQYPDDDNVLNQSVDAVIISPGPGHPLDDQQLMK
    Newman          MILVVDNYDSFTYNLVDIVAQHTDVIVQYPDDDNVLNQSVDAVIISPGPGHPLDDQQLMK
    USA300_FPR3757  MILVVDNYDSFTYNLVDIVAQHTDVIVQYPDDDNVLNQSVDAVIISPGPGHPLDDQQLMK
                    ************************************************************

    COL             IISTYQHKPILGICLGAQALTCYYGGEVIKGDKVMHGKVDTLKVISHHQHLLYQDIPEQF
    N315            IISTYQHKPILGICLGAQALTCYYGGEVIKGDKVMHGKVDTLKVISHHQHLLYQDIPEQF
    NCTC8325        IISTYQHKPILGICLGAQALTCYYGGEVIKGDKVMHGKVDTLKVISHHQHLLYQDIPEQF
    Newman          IISTYQHKPILGICLGAQALTCYYGGEVIKGDKVMHGKVDTLKVISHHQHLLYQDIPEQF
    USA300_FPR3757  IISTYQHKPILGICLGAQALTCYYGGEVIKGDKVMHGKVDTLKVISHHQHLLYQDIPEQF
                    ************************************************************

    COL             SIMRYHSLISNPDNFPEELKITGRTKDCIQSFEHKERPHYGIQYHPESFATDYGVKIITN
    N315            SIMRYHSLISNPDNFPEELKITGRTEDCIQSFEHKERPHYGIQYHPESFATDYGVKIITN
    NCTC8325        SIMRYHSLISNPDNFPEELKITGRTKDCIQSFEHKERPHYGIQYHPESFATDYGVKIITN
    Newman          SIMRYHSLISNPDNFPEELKITGRTKDCIQSFEHKERPHYGIQYHPESFATDYGVKIITN
    USA300_FPR3757  SIMRYHSLISNPDNFPEELKITGRTKDCIQSFEHKERPHYGIQYHPESFATDYGVKIITN
                    *************************:**********************************

    COL             FINLVKEG
    N315            FINLVKEG
    NCTC8325        FINLVKEG
    Newman          FINLVKEG
    USA300_FPR3757  FINLVKEG
                    ********