From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1280 [new locus tag: NWMN_RS07215 ]
  • pan locus tag?: SAUPAN003763000
  • symbol: trpG
  • pan gene symbol?: trpG
  • synonym:
  • product: anthranilate synthase component II

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1280 [new locus tag: NWMN_RS07215 ]
  • symbol: trpG
  • product: anthranilate synthase component II
  • replicon: chromosome
  • strand: +
  • coordinates: 1411795..1412361
  • length: 567
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATCTTAGTTGTAGATAATTATGATTCCTTTACATATAACCTAGTGGATATTGTTGCT
    CAACATACTGACGTCATTGTTCAATACCCTGATGATGATAATGTGCTGAATCAATCGGTG
    GACGCTGTTATTATATCTCCTGGTCCAGGGCATCCATTAGACGATCAACAGTTAATGAAA
    ATCATATCAACCTATCAACACAAACCCATTTTAGGTATTTGTTTAGGGGCTCAGGCACTG
    ACTTGTTACTACGGTGGAGAAGTCATTAAAGGCGACAAGGTTATGCACGGCAAAGTTGAT
    ACACTAAAGGTTATATCGCATCATCAACATCTGTTATATCAAGATATACCAGAACAGTTT
    TCAATTATGAGATATCATTCATTAATAAGTAACCCTGACAATTTTCCAGAAGAATTGAAA
    ATTACTGGACGTACCAAAGATTGTATACAGTCATTCGAGCATAAAGAAAGACCGCATTAT
    GGTATTCAGTACCATCCTGAATCATTTGCTACAGACTATGGTGTCAAAATAATTACAAAT
    TTCATTAATCTAGTGAAGGAAGGATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    567

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1280 [new locus tag: NWMN_RS07215 ]
  • symbol: TrpG
  • description: anthranilate synthase component II
  • length: 188
  • theoretical pI: 5.68556
  • theoretical MW: 21368.1
  • GRAVY: -0.254787

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (TIGR00566; HMM-score: 151)
    aminodeoxychorismate synthase (TIGR01823; EC 2.6.1.85; HMM-score: 125.7)
    MetabolismAmino acid biosynthesisAromatic amino acid familyanthranilate synthase (TIGR01815; EC 4.1.3.27; HMM-score: 115)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisGMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 92.5)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesiscarbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 49.5)
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 28.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisCTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 17.5)
  • TheSEED:  
    Amino Acids and DerivativesAromatic amino acids and derivativesTryptophan synthesis Anthranilate synthase, amidotransferase component (EC 4.1.3.27) 
  • PFAM:
    Glutaminase_I (CL0014) GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 125.6)
    Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 35.4)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 15.9)
    KaiA_RbsU (CL0637) KaiA; KaiA C-terminal domain (PF07688; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_1587(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    NWMN_0745(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    NWMN_0741(gapA)glyceraldehyde 3-phosphate dehydrogenase 1  [1] (data from MRSA252)
    NWMN_1580(gapB)glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    NWMN_2056(glmS)glucosamine--fructose-6-phosphate aminotransferase  [1] (data from MRSA252)
    NWMN_1501(pfs)5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase  [1] (data from MRSA252)
    NWMN_0499(rplK)50S ribosomal protein L11  [1] (data from MRSA252)
    NWMN_1166(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_2119(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    NWMN_1254(tkt)transketolase  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_08543-oxoacyl-(acyl-carrier-protein) synthase II  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.11
    • Ymax_pos: 30
    • Cmax: 0.125
    • Cmax_pos: 23
    • Smax: 0.166
    • Smax_pos: 20
    • Smean: 0.085
    • D: 0.1
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MILVVDNYDSFTYNLVDIVAQHTDVIVQYPDDDNVLNQSVDAVIISPGPGHPLDDQQLMKIISTYQHKPILGICLGAQALTCYYGGEVIKGDKVMHGKVDTLKVISHHQHLLYQDIPEQFSIMRYHSLISNPDNFPEELKITGRTKDCIQSFEHKERPHYGIQYHPESFATDYGVKIITNFINLVKEG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]