From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003769000
  • symbol?: femA
  • description?: aminoacyltransferase FemA

      descriptions from strain specific annotations:

    • aminoacyltransferase FemA
    • methicillin resistance protein FemA
    • femA protein
    • factor essential for expression of methicillin resistance
    • methicillin resistance factor FemA
    • aminoacyltransferase FemA (Factor essential forexpression of methicillin resistance A)
    • FemA, factor essential for methicillin resistance / Glycine interpeptide bridge formation
    • femAB family protein
    • glycine interpeptide bridge formation protein FemA
    • methicillin resistance factor, FemA
    • methicillin resistance protein
    • tRNA-dependent lipid II-Gly--glycine ligase
    • UDP-N-acetylmuramoylpentapeptide-glycine glycyltransferase
  • strand?: +
  • coordinates?: 4066368..4067707
  • synteny block?: BlockID0028310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1410 (femA)
    N315:
    SA1206 (femA)
    NCTC8325:
    Newman:
    NWMN_1286 (femA)
    USA300_FPR3757:
    04-02981:
    SA2981_1328 (femA)
    08BA02176:
    C248_1412 (femA)
    11819-97:
    MS7_1331
    71193:
    ST398NM01_1375
    ECT-R 2:
    ECTR2_1231
    ED133:
    SAOV_1384
    ED98:
    SAAV_1356 (femA)
    HO 5096 0412:
    SAEMRSA15_12220 (femA)
    JH1:
    SaurJH1_1464
    JH9:
    SaurJH9_1435
    JKD6008:
    SAA6008_01339 (femA)
    JKD6159:
    SAA6159_01241 (femA)
    LGA251:
    SARLGA251_12830 (femA)
    M013:
    M013TW_1320
    MRSA252:
    SAR1387 (femA)
    MSHR1132:
    SAMSHR1132_12170
    MSSA476:
    SAS1314
    Mu3:
    SAHV_1362 (femA)
    Mu50:
    SAV1374 (femA)
    MW2:
    MW1261 (femA)
    RF122:
    SAB1229 (femA)
    ST398:
    SAPIG1375
    T0131:
    SAT0131_01446 (hlgB)
    TCH60:
    HMPREF0772_11833 (femA)
    TW20:
    SATW20_13740 (femA)
    USA300_TCH1516:
    USA300HOU_1309 (femA)
    VC40:
    SAVC_06120

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLINERQIGVMIMKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKN
    N315            -------------MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKN
    NCTC8325        -------------MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKN
    Newman          -------------MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKN
    USA300_FPR3757  MKLINERQIGVMIMKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKN
                                 ***********************************************

    COL             NNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHI
    N315            NNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHI
    NCTC8325        NNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHI
    Newman          NNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHI
    USA300_FPR3757  NNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHI
                    ************************************************************

    COL             DPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKT
    N315            DPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKT
    NCTC8325        DPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKT
    Newman          DPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKT
    USA300_FPR3757  DPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKT
                    ************************************************************

    COL             ADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMEDTSESKAFADRDDKFYYN
    N315            ADDIIKNMDGLRKRNTKKVKKNGVKVRYLSEEELPIFRSFMEDTSESKAFADRDDKFYYN
    NCTC8325        ADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMEDTSESKAFADRDDKFYYN
    Newman          ADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMEDTSESKAFADRDDKFYYN
    USA300_FPR3757  ADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMEDTSESKAFADRDDKFYYN
                    ***************************:********************************

    COL             RLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQ
    N315            RLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQ
    NCTC8325        RLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQ
    Newman          RLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQ
    USA300_FPR3757  RLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQ
                    ************************************************************

    COL             QQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQW
    N315            QQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQW
    NCTC8325        QQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQW
    Newman          QQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQW
    USA300_FPR3757  QQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQW
                    ************************************************************

    COL             EMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYA
    N315            EMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYA
    NCTC8325        EMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYA
    Newman          EMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYA
    USA300_FPR3757  EMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYA
                    ************************************************************

    COL             AYTALKKVKDRIF
    N315            AYTALKKVKDRIF
    NCTC8325        AYTALKKVKDRIF
    Newman          AYTALKKVKDRIF
    USA300_FPR3757  AYTALKKVKDRIF
                    *************