From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003770000
  • symbol?: femB
  • description?: aminoacyltransferase FemB

      descriptions from strain specific annotations:

    • aminoacyltransferase FemB
    • femB protein
    • methicillin resistance factor
    • methicillin resistance expression factor FemB
    • methicillin resistance protein FemB
    • putative methicillin resistance expressionfactor
    • aminoacyltransferase FemB (Factor essential forexpression of methicillin resistance B)
    • femAB family protein
    • FemB, factor involved in methicillin resistance / Glycine interpeptide bridge formation
    • glycine interpeptide bridge formation protein FemB
    • methicillin resistance factor FemB
    • methicillin resistance factor protein
    • methicillin resistance protein
    • UDP-N-acetylmuramoylpentapeptide-triglycine glycyltransferase
  • strand?: +
  • coordinates?: 4067726..4068985
  • synteny block?: BlockID0028320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1207 (femB)
    NCTC8325:
    Newman:
    NWMN_1287 (femB)
    USA300_FPR3757:
    04-02981:
    SA2981_1329 (femB)
    08BA02176:
    C248_1413 (femB)
    11819-97:
    MS7_1332 (femB)
    71193:
    ST398NM01_1376
    ECT-R 2:
    ECTR2_1232
    ED133:
    SAOV_1385
    ED98:
    SAAV_1357
    HO 5096 0412:
    SAEMRSA15_12230 (femB)
    JH1:
    SaurJH1_1465
    JH9:
    SaurJH9_1436
    JKD6008:
    SAA6008_01340 (femB)
    JKD6159:
    SAA6159_01242 (femB)
    LGA251:
    SARLGA251_12840 (femB)
    M013:
    M013TW_1321
    MRSA252:
    SAR1388 (femB)
    MSHR1132:
    SAMSHR1132_12180
    MSSA476:
    SAS1315
    Mu3:
    SAHV_1363 (femB)
    Mu50:
    SAV1375 (femB)
    MW2:
    MW1262 (femB)
    RF122:
    SAB1230 (femB)
    ST398:
    SAPIG1376
    T0131:
    SAT0131_01447 (bioX)
    TCH60:
    HMPREF0772_11832 (femB)
    TW20:
    SATW20_13750 (femB)
    USA300_TCH1516:
    USA300HOU_1310 (femB)
    VC40:
    SAVC_06125

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFTELTVTEFDNFVQNPSLESHYFQVKENIVTRENDGFEVVLLGIKDDNNKVIAASLFS
    N315            MKFTELTVTEFDNFVQNPSLESHYFQVKENIVTRENDGFEVVLLGIKDDNNKVIAASLFS
    NCTC8325        MKFTELTVTEFDNFVQNPSLESHYFQVKENIVTRENDGFEVVLLGIKDDNNKVIAASLFS
    Newman          MKFTELTVTEFDNFVQNPSLESHYFQVKENIVTRENDGFEVVLLGIKDDNNKVIAASLFS
    USA300_FPR3757  MKFTELTVTEFDNFVQNPSLESHYFQVKENIVTRENDGFEVVLLGIKDDNNKVIAASLFS
                    ************************************************************

    COL             KIPTMGSYVYYSNRGPVMDFSDLGLVDYYLKELDKYLQQHQCLYVKLDPYWLYHLYDKDI
    N315            KIPTMGSYVYYSNRGPVMDFSDLGLVDYYLKELDKYLQQHQCLYVKLDPYWLYHLYDKDI
    NCTC8325        KIPTMGSYVYYSNRGPVMDFSDLGLVDYYLKELDKYLQQHQCLYVKLDPYWLYHLYDKDI
    Newman          KIPTMGSYVYYSNRGPVMDFSDLGLVDYYLKELDKYLQQHQCLYVKLDPYWLYHLYDKDI
    USA300_FPR3757  KIPTMGSYVYYSNRGPVMDFSDLGLVDYYLKELDKYLQQHQCLYVKLDPYWLYHLYDKDI
                    ************************************************************

    COL             VPFEGREKNDALVNLFKSHGYEHHGFTTEYDTSSQVRWMGVLNLEGKTPETLKKTFDSQR
    N315            VPFEGREKNDALVNLFKSHGYEHHGFTTEYDTSSQVRWMGVLNLEGKTPETLKKTFDSQR
    NCTC8325        VPFEGREKNDALVNLFKSHGYEHHGFTTEYDTSSQVRWMGVLNLEGKTPETLKKTFDSQR
    Newman          VPFEGREKNDALVNLFKSHGYEHHGFTTEYDTSSQVRWMGVLNLEGKTPETLKKTFDSQR
    USA300_FPR3757  VPFEGREKNDALVNLFKSHGYEHHGFTTEYDTSSQVRWMGVLNLEGKTPETLKKTFDSQR
                    ************************************************************

    COL             KRNINKAINYGVKVRFLERDEFNLFLDLYRETEERAGFVSKTDDYFYNFIDTYGDKVLVP
    N315            KRNINKAINYGVKVRFLERDEFNLFLDLYRETEERAGFVSKTDDYFYNFIDTYGDKVLVP
    NCTC8325        KRNINKAINYGVKVRFLERDEFNLFLDLYRETEERAGFVSKTDDYFYNFIDTYGDKVLVP
    Newman          KRNINKAINYGVKVRFLERDEFNLFLDLYRETEERAGFVSKTDDYFYNFIDTYGDKVLVP
    USA300_FPR3757  KRNINKAINYGVKVRFLERDEFNLFLDLYRETEERAGFVSKTDDYFYNFIDTYGDKVLVP
                    ************************************************************

    COL             LAYIDLDEYVLKLQQELNDKENRRDQMMAKENKSDKQMKKIAELDKQIDHDQHELLNASE
    N315            LAYIDLDEYVLKLQQELNDKENRRDQMMAKENKSDKQMKKIAELDKQIDHDQHELLNASE
    NCTC8325        LAYIDLDEYVLKLQQELNDKENRRDQMMAKENKSDKQMKKIAELDKQIDHDQHELLNASE
    Newman          LAYIDLDEYVLKLQQELNDKENRRDQMMAKENKSDKQMKKIAELDKQIDHDQHELLNASE
    USA300_FPR3757  LAYIDLDEYVLKLQQELNDKENRRDQMMAKENKSDKQMKKIAELDKQIDHDQHELLNASE
                    ************************************************************

    COL             LSKTDGPILNLASGVYFANAYEVNYFSGGSSEKYNQFMGPYMMHWFMINYCFDNGYDRYN
    N315            LSKTDGPILNLASGVYFANAYEVNYFSGGSSEKYNQFMGPYMMHWFMINYCFDNGYDRYN
    NCTC8325        LSKTDGPILNLASGVYFANAYEVNYFSGGSSEKYNQFMGPYMMHWFMINYCFDNGYDRYN
    Newman          LSKTDGPILNLASGVYFANAYEVNYFSGGSSEKYNQFMGPYMMHWFMINYCFDNGYDRYN
    USA300_FPR3757  LSKTDGPILNLASGVYFANAYEVNYFSGGSSEKYNQFMGPYMMHWFMINYCFDNGYDRYN
                    ************************************************************

    COL             FYGLSGDFTENSEDYGVYRFKRGFNVQIEELIGDFYKPIHKVKYWLFTTLDKLRKKLKK
    N315            FYGLSGDFTENSEDYGVYRFKRGFNVQIEELIGDFYKPIHKVKYWLFTTLDKLRKKLKK
    NCTC8325        FYGLSGDFTENSEDYGVYRFKRGFNVQIEELIGDFYKPIHKVKYWLFTTLDKLRKKLKK
    Newman          FYGLSGDFTENSEDYGVYRFKRGFNVQIEELIGDFYKPIHKVKYWLFTTLDKLRKKLKK
    USA300_FPR3757  FYGLSGDFTENSEDYGVYRFKRGFNVQIEELIGDFYKPIHKVKYWLFTTLDKLRKKLKK
                    ***********************************************************