From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003798000
  • symbol?: pstS
  • description?: phosphate-binding protein PstS (PBP)

      descriptions from strain specific annotations:

    • phosphate-binding protein PstS (PBP)
    • phosphate-binding lipoprotein
    • thioredoxine reductase
    • phosphate binding protein
    • phosphate ABC transporter substrate-binding protein
    • Phosphate ABC transporter, periplasmic phosphate-binding protein PstS
    • phosphate binding family protein
    • phosphate ABC transporter phosphate-binding protein PstS
    • phosphate ABC transporter periplasmic phosphate-binding protein
    • phosphate ABC transporter ATP-binding protein
    • phosphate ABC transporter periplasmic protein
    • Phosphate-binding protein pstS
  • strand?: -
  • coordinates?: 4090833..4091948
  • synteny block?: BlockID0028550
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1300 (pstS)
    USA300_FPR3757:
    04-02981:
    SA2981_1343 (pstS)
    08BA02176:
    C248_1428
    11819-97:
    MS7_1346 (pstS)
    71193:
    ECT-R 2:
    ECTR2_1246 (pstS)
    ED133:
    ED98:
    SAAV_1371
    HO 5096 0412:
    SAEMRSA15_12530
    JH1:
    SaurJH1_1479
    JH9:
    SaurJH9_1450
    JKD6008:
    SAA6008_01353 (pstS)
    JKD6159:
    SAA6159_01256 (pstS)
    LGA251:
    SARLGA251_13060
    M013:
    M013TW_1334
    MRSA252:
    SAR1402
    MSHR1132:
    SAMSHR1132_12310
    MSSA476:
    SAS1330
    Mu3:
    SAHV_1377
    Mu50:
    SAV1389
    MW2:
    MW1277
    RF122:
    SAB1245c
    ST398:
    SAPIG1390
    T0131:
    SAT0131_01462
    TCH60:
    HMPREF0772_11819 (pstS)
    TW20:
    SATW20_13880
    USA300_TCH1516:
    USA300HOU_1324 (pstS)
    VC40:
    SAVC_06190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH
    N315            MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH
    NCTC8325        MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH
    Newman          MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH
    USA300_FPR3757  MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH
                    ************************************************************

    COL             SDAKISAGQAGTGAGFQKFIAGDIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQDGVTV
    N315            SDAKISAGQAGTGAGFQKFIAGDIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQDGVTV
    NCTC8325        SDAKISAGQAGTGAGFQKFIAGDIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQDGVTV
    Newman          SDAKISAGQAGTGAGFQKFIAGDIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQDGVTV
    USA300_FPR3757  SDAKISAGQAGTGAGFQKFIAGDIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQDGVTV
                    ************************************************************

    COL             AVNKENDFVDELDKQQLKAIYSGKAKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM
    N315            AVNKENDFVDELDKQQLKAIYSGKAKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM
    NCTC8325        AVNKENDFVDELDKQQLKAIYSGKAKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM
    Newman          AVNKENDFVDELDKQQLKAIYSGKAKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM
    USA300_FPR3757  AVNKENDFVDELDKQQLKAIYSGKAKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM
                    ************************************************************

    COL             NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKK
    N315            NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKK
    NCTC8325        NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKK
    Newman          NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKK
    USA300_FPR3757  NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKK
                    ************************************************************

    COL             TIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAEEAGYVAAPEKTYKSQL
    N315            TIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAEEAGYVAAPEKTYKSQL
    NCTC8325        TIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAEEAGYVAAPEKTYKSQL
    Newman          TIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAEEAGYVAAPEKTYKSQL
    USA300_FPR3757  TIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAEEAGYVAAPEKTYKSQL
                    ************************************************************

    COL             DDLKAFIDKNQKSDDKKSDDKKSEDKK
    N315            DDLKAFIDKNQKSDDKKSDDKKSEDKK
    NCTC8325        DDLKAFIDKNQKSDDKKSDDKKSEDKK
    Newman          DDLKAFIDKNQKSDDKKSDDKKSEDKK
    USA300_FPR3757  DDLKAFIDKNQKSDDKKSDDKKSEDKK
                    ***************************