From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003812000
  • symbol?: alr2
  • description?: alanine racemase

      descriptions from strain specific annotations:

    • alanine racemase
    • alanine racemase family protein
    • Diaminopimelate epimerase
    • alanine racemase, C-terminal domain protein
    • putative alanine racemase
    • alanine racemase 2
  • strand?: +
  • coordinates?: 4103092..4104177
  • synteny block?: BlockID0028690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1310 (alr2)
    USA300_FPR3757:
    04-02981:
    SA2981_1353
    08BA02176:
    C248_1438 (dal)
    11819-97:
    MS7_1355
    71193:
    ST398NM01_1400
    ECT-R 2:
    ECTR2_1256
    ED133:
    SAOV_1408 (alr)
    ED98:
    SAAV_1382
    HO 5096 0412:
    SAEMRSA15_12620 (dal)
    JH1:
    SaurJH1_1489
    JH9:
    SaurJH9_1460
    JKD6008:
    SAA6008_01363 (alr2)
    JKD6159:
    SAA6159_01265 (alr2)
    LGA251:
    SARLGA251_13150 (dal)
    M013:
    M013TW_1343
    MRSA252:
    SAR1411 (dal)
    MSHR1132:
    SAMSHR1132_12400
    MSSA476:
    SAS1340
    Mu3:
    SAHV_1387
    Mu50:
    SAV1399
    MW2:
    MW1287
    RF122:
    SAB1254 (alr)
    ST398:
    SAPIG1400
    T0131:
    SAT0131_01474 (bcr)
    TCH60:
    HMPREF0772_11810 (dal)
    TW20:
    SATW20_13980 (dal)
    USA300_TCH1516:
    USA300HOU_1334 (alr1)
    VC40:
    SAVC_06240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTATWSVNKKIFLQNAITVKNNQPLMAVVKNNAYHYDLEFAVTQFIHAGIDTFSTTSLRE
    N315            MTATWSVNKKIFLQNAITVKNNQPLMAVVKNNAYHYDLEFAVTQFIHAGIDTFSTTSLRE
    NCTC8325        MTATWSVNKKIFLQNAITVKNNQPLMAVVKNNAYHYDLEFAVTQFIHAGIDTFSTTSLRE
    Newman          MTATWSVNKKIFLQNAITVKNNQPLMAVVKNNAYHYDLEFAVTQFIHAGIDTFSTTSLRE
    USA300_FPR3757  MTATWSVNKKIFLQNAITVKNNQPLMAVVKNNAYHYDLEFAVTQFIHAGIDTFSTTSLRE
                    ************************************************************

    COL             AIQIRQLAPDATIFLMNAVYEFDLVREHQIHMTLPSLTYYYNHKNDLAGIHVHLEFENLL
    N315            AIQIRQLAPDATIFLMNAVYEFDLVREHQIHMTLPSLTYYYNHKNDLAGIHVHLEFENLL
    NCTC8325        AIQIRQLAPDATIFLMNAVYEFDLVREHQIHMTLPSLTYYYNHKNDLAGIHVHLEFENLL
    Newman          AIQIRQLAPDATIFLMNAVYEFDLVREHQIHMTLPSLTYYYNHKNDLAGIHVHLEFENLL
    USA300_FPR3757  AIQIRQLAPDATIFLMNAVYEFDLVREHQIHMTLPSLTYYYNHKNDLAGIHVHLEFENLL
                    ************************************************************

    COL             HRSGFKDLNEIKEVLKDHHHNQNAKMIISGLWTHFGYADEFDVSDYNVERSQWMEIVEAL
    N315            HRSGFKDLNEIKEVLKDHHHNQNAKMIISGLWTHFGYADEFDVSDYNVERSQWMEIVEAL
    NCTC8325        HRSGFKDLNEIKEVLKDHHHNQNAKMIISGLWTHFGYADEFDVSDYNVERSQWMEIVEAL
    Newman          HRSGFKDLNEIKEVLKDHHHNQNAKMIISGLWTHFGYADEFDVSDYNVERSQWMEIVEAL
    USA300_FPR3757  HRSGFKDLNEIKEVLKDHHHNQNAKMIISGLWTHFGYADEFDVSDYNVERSQWMEIVEAL
                    ************************************************************

    COL             LSEGYQFDLIHAQNSASFYREGQILLPHHTHARVGIALYGSRPYSSLNQHDIVQSLTLKA
    N315            LSEGYQFDLIHAQNSASFYREGQILLPHHTHARVGIALYGSRPYSSLNQHDIVQSLTVKA
    NCTC8325        LSEGYQFDLIHAQNSASFYREGQILLPHHTHARVGIALYGSRPYSSLNQHDIVQSLTLKA
    Newman          LSEGYQFDLIHAQNSASFYREGQILLPHHTHARVGIALYGSRPYSSLNQHDIVQSLTLKA
    USA300_FPR3757  LSEGYQFDLIHAQNSASFYREGQILLPHHTHARVGIALYGSRPYSSLNQHDIVQSLTLKA
                    *********************************************************:**

    COL             HVIQVREVQAGDYCGYSFAFEVTKNNTKLAVVDIGYGDGILRTRAKHEALINGKRYPIRA
    N315            HVIQVREVQAGDYCGYSFAFEVTKNNTKLAVVDIGYGDGILRTRAKHEALINGKRYPIRA
    NCTC8325        HVIQVREVQAGDYCGYSFAFEVTKNNTKLAVVDIGYGDGILRTRAKHEALINGKRYPIRA
    Newman          HVIQVREVQAGDYCGYSFAFEVTKNNTKLAVVDIGYGDGILRTRAKHEALINGKRYPIRA
    USA300_FPR3757  HVIQVREVQAGDYCGYSFAFEVTKNNTKLAVVDIGYGDGILRTRAKHEALINGKRYPIRA
                    ************************************************************

    COL             LMMSHMFVEVDGNVHAQDEVILYNNDIRIDEYTFKGVGANSEQLSAMNHDSLKKEYISND
    N315            LMMSHMFVEVDGNVHAQDEVILYNNDIRIDEYTFKGVGANSEQLSAMNHDSLKKEYISND
    NCTC8325        LMMSHMFVEVDGNVHAQDEVILYNNDIRIDEYTFKGVGANSEQLSAMNHDSLKKEYISND
    Newman          LMMSHMFVEVDGNVHAQDEVILYNNDIRIDEYTFKGVGANSEQLSAMNHDSLKKEYISND
    USA300_FPR3757  LMMSHMFVEVDGNVHAQDEVILYNNDIRIDEYTFKGVGANSEQLSAMNHDSLKKEYISND
                    ************************************************************

    COL             C
    N315            C
    NCTC8325        C
    Newman          C
    USA300_FPR3757  C
                    *