From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003835000
  • symbol?: arlR
  • description?: DNA-binding response regulator ArlR

      descriptions from strain specific annotations:

    • DNA-binding response regulator ArlR
    • two component transcriptional regulator
    • response regulator receiver
    • two-component response regulator
    • truncated response regulator
    • Putative response regulator ArlR
    • Response regulator ArlR
    • truncated ( response regulator ArlR
    • response regulator protein
    • transcriptional regulatory protein ResD
    • truncated (putative response regulator ArlR
  • strand?: -
  • coordinates?: 4125272..4125931
  • synteny block?: BlockID0028920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1451 (arlR)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1369 (arlR)
    08BA02176:
    C248_1454 (arlR)
    11819-97:
    MS7_1371 (arlR)
    71193:
    ST398NM01_1417
    ECT-R 2:
    ECTR2_1272
    ED133:
    SAOV_1425c
    ED98:
    SAAV_1399 (arlR)
    HO 5096 0412:
    SAEMRSA15_12780 (arlR)
    JH1:
    SaurJH1_1505
    JH9:
    SaurJH9_1476
    JKD6008:
    SAA6008_01381 (arlR)
    JKD6159:
    SAA6159_01282 (arlR)
    LGA251:
    SARLGA251_13320 (arlR)
    M013:
    M013TW_1362
    MRSA252:
    SAR1427 (arlR)
    MSHR1132:
    SAMSHR1132_12560
    MSSA476:
    SAS1358
    Mu3:
    SAHV_1403
    Mu50:
    SAV1415 (truncated-arlR)
    MW2:
    MW1305
    RF122:
    SAB1271c (arlR)
    ST398:
    SAPIG1417
    T0131:
    SAT0131_01493
    TCH60:
    HMPREF0772_11792
    TW20:
    SATW20_14160 (arlR)
    USA300_TCH1516:
    USA300HOU_1350 (arlR)
    VC40:
    SAVC_06325

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSING
    N315            ------------------------------------------------------------
    NCTC8325        MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSING
    Newman          MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSING
    USA300_FPR3757  MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSING
                                                                                

    COL             LEICRKIRQQQSTPIIIITAKSDTYDKVAGLDYGADDYIVKPFDIEELLARIRAILRRQP
    N315            ------------------------------------------------------------
    NCTC8325        LEICRKIRQQQSTPIIIITAKSDTYDKVAGLDYGADDYIVKPFDIEELLARIRAILRRQP
    Newman          LEICRKIRQQQSTPIIIITAKSDTYDKVAGLDYGADDYIVKPFDIEELLARIRAILRRQP
    USA300_FPR3757  LEICRKIRQQQSTPIIIITAKSDTYDKVAGLDYGADDYIVKPFDIEELLARIRAILRRQP
                                                                                

    COL             QKDIIDVNGITIDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYN
    N315            ------------------MTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYN
    NCTC8325        QKDIIDVNGITIDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYN
    Newman          QKDIIDVNGITIDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYN
    USA300_FPR3757  QKDIIDVNGITIDKNAFKVTVNGAEIELTKTEYDLLYLLAENKNHVMQREQILNHVWGYN
                                      :*****************************************

    COL             SEVETNVVDVYIRYLRNKLKPYDRDKMIETVRGVGYVIR
    N315            SEVETNVVDVYIRYLRNKLKPYDRDKMIETVRGVGYVIR
    NCTC8325        SEVETNVVDVYIRYLRNKLKPYDRDKMIETVRGVGYVIR
    Newman          SEVETNVVDVYIRYLRNKLKPYDRDKMIETVRGVGYVIR
    USA300_FPR3757  SEVETNVVDVYIRYLRNKLKPYDRDKMIETVRGVGYVIR
                    ***************************************