From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003920000
  • symbol?:
  • description?: metal-dependent peptidase

      descriptions from strain specific annotations:

    • metal-dependent peptidase
    • neutral zinc metallopeptidase family protein
    • putative neutral zinc metallopeptidase
    • putative metal-dependent peptidase
    • Zn-dependent protease
    • membrane protein
  • strand?: -
  • coordinates?: 4241613..4242293
  • synteny block?: BlockID0029660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1416
    08BA02176:
    C248_1500
    11819-97:
    MS7_1416
    71193:
    ST398NM01_1460
    ECT-R 2:
    ECTR2_1314
    ED133:
    SAOV_1468
    ED98:
    SAAV_1447
    HO 5096 0412:
    SAEMRSA15_13210
    JH1:
    SaurJH1_1548
    JH9:
    SaurJH9_1519
    JKD6008:
    SAA6008_01429
    JKD6159:
    SAA6159_01325
    LGA251:
    SARLGA251_13740
    M013:
    M013TW_1408
    MRSA252:
    SAR1471
    MSHR1132:
    SAMSHR1132_13000
    MSSA476:
    SAS1403
    Mu3:
    SAHV_1448
    Mu50:
    SAV1460
    MW2:
    MW1350
    RF122:
    SAB1324c
    ST398:
    SAPIG1460
    T0131:
    SAT0131_01549
    TCH60:
    HMPREF0772_11744
    TW20:
    SATW20_14590
    USA300_TCH1516:
    USA300HOU_1398
    VC40:
    SAVC_06555

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLLSSIFTMIIYFVILMVLPLWAQHKVKSNYEKYSQVRSTSGKTGREVALEILHANGIY
    N315            ---MSSIFTMIIYFVILMVLPLWAQHKVKSNYEKYSQVRSTSGKTGREVALEILHANGIY
    NCTC8325        ---------MIIYFVILMVLPLWAQHKVKSNYEKYSQVRSTSGKTGREVALEILHANGIY
    Newman          MSLLSSIFTMIIYFVILMVLPLWAQHKVKSNYEKYSQVRSTSGKTGREVALEILHANGIY
    USA300_FPR3757  ---------MIIYFVILMVLPLWAQHKVKSNYEKYSQVRSTSGKTGREVALEILHANGIY
                             ***************************************************

    COL             DVEVVKGEGFLTDHYDPKKKVVSLSPANYDRPSVAGTAIAAHEVGHAIQDHQGYWFLRFR
    N315            DVEVVKGEGFLTDHYDPKKKVVSLSPANYDRPSVAGTAIAAHEVGHAIQDHQGYWFLRFR
    NCTC8325        DVEVVKGEGFLTDHYDPKKKVVSLSPANYDRPSVAGTAIAAHEVGHAIQDHQGYWFLRFR
    Newman          DVEVVKGEGFLTDHYDPKKKVVSLSPANYDRPSVAGTAIAAHEVGHAIQDHQGYWFLRFR
    USA300_FPR3757  DVEVVKGEGFLTDHYDPKKKVVSLSPANYDRPSVAGTAIAAHEVGHAIQDHQGYWFLRFR
                    ************************************************************

    COL             AALVPVANLGSSLSYMIIMLGIILTAIGSAFGSTALWIGAGLMSLAVLFSIVTLPVEFDA
    N315            AALVPVANLGSSLSYMIIMLGIILTAIGSAFGSTALWIGAGLMSLAVLFSIVTLPVEFDA
    NCTC8325        AALVPVANLGSSLSYMIIMLGIILTAIGSAFGSTALWIGAGLMSLAVLFSIVTLPVEFDA
    Newman          AALVPVANLGSSLSYMIIMLGIILTAIGSAFGSTALWIGAGLMSLAVLFSIVTLPVEFDA
    USA300_FPR3757  AALVPVANLGSSLSYMIIMLGIILTAIGSAFGSTALWIGAGLMSLAVLFSIVTLPVEFDA
                    ************************************************************

    COL             SSRAMKQITALNIVNEKEYKHARKVLSAAAMTYVAATAVAVAELVRIILIARSSD
    N315            SSRAMKQITALNIVNEKEYKHARKVLSAAAMTYVAATAVAVAELVRIILIARSSD
    NCTC8325        SSRAMKQITALNIVNEKEYKHARKVLSAAAMTYVAATAVAVAELVRIILIARSSD
    Newman          SSRAMKQITALNIVNEKEYKHARKVLSAAAMTYVAATAVAVAELVRIILIARSSD
    USA300_FPR3757  SSRAMKQITALNIVNEKEYKHARKVLSAAAMTYVAATAVAVAELVRIILIARSSD
                    *******************************************************