From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1351 [new locus tag: SAUSA300_RS07365 ]
  • pan locus tag?: SAUPAN003920000
  • symbol: SAUSA300_1351
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1351 [new locus tag: SAUSA300_RS07365 ]
  • symbol: SAUSA300_1351
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1518221..1518901
  • length: 681
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAATTTATTTCGTAATATTAATGGTGCTTCCTTTATGGGCACAACACAAAGTTAAA
    TCTAACTATGAGAAATATTCACAAGTTAGATCAACTAGTGGTAAAACGGGTCGTGAAGTT
    GCATTAGAAATTTTACATGCAAACGGTATTTATGATGTCGAAGTTGTTAAAGGTGAAGGA
    TTCTTAACAGATCATTACGATCCTAAAAAGAAAGTTGTTTCACTATCTCCTGCAAACTAT
    GACAGACCATCAGTTGCTGGAACTGCAATTGCAGCCCACGAAGTTGGTCATGCCATTCAA
    GATCACCAAGGATATTGGTTCTTAAGATTCAGAGCAGCATTAGTACCTGTTGCAAACCTA
    GGGAGTTCATTAAGTTATATGATCATCATGTTAGGTATTATCTTAACAGCGATAGGTAGT
    GCATTTGGTTCAACTGCTTTATGGATTGGTGCTGGTTTAATGTCATTAGCGGTATTATTC
    TCAATTGTTACGTTACCAGTTGAGTTTGATGCGAGTTCAAGAGCGATGAAACAAATTACG
    GCATTGAACATTGTAAATGAAAAAGAATACAAGCATGCGCGTAAAGTATTATCTGCAGCA
    GCAATGACTTATGTTGCAGCAACTGCAGTCGCTGTAGCAGAGCTTGTACGTATTATTTTG
    ATTGCGCGTTCAAGTGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    681

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1351 [new locus tag: SAUSA300_RS07365 ]
  • symbol: SAUSA300_1351
  • description: hypothetical protein
  • length: 226
  • theoretical pI: 9.59502
  • theoretical MW: 24581.6
  • GRAVY: 0.406195

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family (TIGR03074; EC 1.1.-.-; HMM-score: 6.5)
  • TheSEED:  
    probable metal-dependent peptidase 
  • PFAM:
    Peptidase_MA (CL0126) Zn_peptidase_2; Putative neutral zinc metallopeptidase (PF04298; HMM-score: 295.1)
    DUF4157; Domain of unknown function (DUF4157) (PF13699; HMM-score: 16.7)
    GPCR_A (CL0192) DUF3522; Protein of unknown function (DUF3522) (PF12036; HMM-score: 12.3)
    no clan definedDUF2721; Protein of unknown function (DUF2721) (PF11026; HMM-score: 6.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.35
    • Cellwall Score: 0.32
    • Extracellular Score: 0.32
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.268
    • Ymax_pos: 23
    • Cmax: 0.19
    • Cmax_pos: 23
    • Smax: 0.617
    • Smax_pos: 15
    • Smean: 0.346
    • D: 0.298
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIIYFVILMVLPLWAQHKVKSNYEKYSQVRSTSGKTGREVALEILHANGIYDVEVVKGEGFLTDHYDPKKKVVSLSPANYDRPSVAGTAIAAHEVGHAIQDHQGYWFLRFRAALVPVANLGSSLSYMIIMLGIILTAIGSAFGSTALWIGAGLMSLAVLFSIVTLPVEFDASSRAMKQITALNIVNEKEYKHARKVLSAAAMTYVAATAVAVAELVRIILIARSSD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]