From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003942000
  • symbol?: cmk
  • description?: cytidylate kinase
  • strand?: -
  • coordinates?: 4257664..4258323
  • synteny block?: BlockID0029880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1518 (cmk)
    N315:
    SA1309 (cmk)
    NCTC8325:
    Newman:
    NWMN_1386 (cmk)
    USA300_FPR3757:
    04-02981:
    SA2981_1434 (cmk)
    08BA02176:
    C248_1518 (cmk)
    11819-97:
    MS7_1431 (cmk)
    71193:
    ST398NM01_1476
    ECT-R 2:
    ECTR2_1329 (cmk)
    ED133:
    SAOV_1484 (cmk)
    ED98:
    SAAV_1464 (cmk)
    HO 5096 0412:
    SAEMRSA15_13370 (cmk)
    JH1:
    SaurJH1_1565 (cmk)
    JH9:
    SaurJH9_1534 (cmk)
    JKD6008:
    SAA6008_01446 (cmk)
    JKD6159:
    SAA6159_01341 (cmk)
    LGA251:
    SARLGA251_13900 (cmk)
    M013:
    M013TW_1424
    MRSA252:
    SAR1486 (cmk)
    MSHR1132:
    SAMSHR1132_13160
    MSSA476:
    SAS1418 (cmk)
    Mu3:
    SAHV_1466 (cmk)
    Mu50:
    SAV1478 (cmk)
    MW2:
    MW1366 (cmk)
    RF122:
    SAB1340c (cmk)
    ST398:
    SAPIG1476 (cmk)
    T0131:
    SAT0131_01566
    TCH60:
    HMPREF0772_11728 (cmk)
    TW20:
    SATW20_14750 (cmk)
    USA300_TCH1516:
    USA300HOU_1415 (cmk)
    VC40:
    SAVC_06635 (cmk)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKAINIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLKLNKTEDFAKLVDQ
    N315            MKAINIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLKLNKTEDFAKLVDQ
    NCTC8325        MKAINIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLKLNKTEDFAKLVDQ
    Newman          MKAINIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLKLNKTEDFAKLVDQ
    USA300_FPR3757  MKAINIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLKLNKTEDFAKLVDQ
                    ************************************************************

    COL             TTLDLTYKADKGQCVILDNEDVTDFLRNNDVTQHVSYVASKEPVRSFAVKKQKELAAEKG
    N315            TTLDLTYKADKGQCVILDNEDVTDFLRNNDVTQHVSYVASKEPVRSFAVKKQKELAAEKG
    NCTC8325        TTLDLTYKADKGQCVILDNEDVTDFLRNNDVTQHVSYVASKEPVRSFAVKKQKELAAEKG
    Newman          TTLDLTYKADKGQCVILDNEDVTDFLRNNDVTQHVSYVASKEPVRSFAVKKQKELAAEKG
    USA300_FPR3757  TTLDLTYKADKGQCVILDNEDVTDFLRNNDVTQHVSYVASKEPVRSFAVKKQKELAAEKG
                    ************************************************************

    COL             IVMDGRDIGTVVLPDADLKVYMIASVEERAERRYKDNQLRGIESNFEDLKRDIEARDQYD
    N315            IVMDGRDIGTVVLPDADLKVYMIASVEERAERRYKDNQLRGIESNFEDLKRDIEARDQYD
    NCTC8325        IVMDGRDIGTVVLPDADLKVYMIASVEERAERRYKDNQLRGIESNFEDLKRDIEARDQYD
    Newman          IVMDGRDIGTVVLPDADLKVYMIASVEERAERRYKDNQLRGIESNFEDLKRDIEARDQYD
    USA300_FPR3757  IVMDGRDIGTVVLPDADLKVYMIASVEERAERRYKDNQLRGIESNFEDLKRDIEARDQYD
                    ************************************************************

    COL             MNREISPLRKADDAVTLDTTGKSIEEVTDEILAMVSQIK
    N315            MNREISPLRKADDAVTLDTTGKSIEEVTDEILAMVSQIK
    NCTC8325        MNREISPLRKADDAVTLDTTGKSIEEVTDEILAMVSQIK
    Newman          MNREISPLRKADDAVTLDTTGKSIEEVTDEILAMVSQIK
    USA300_FPR3757  MNREISPLRKADDAVTLDTTGKSIEEVTDEILAMVSQIK
                    ***************************************