From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003943000
  • symbol?: ansA
  • description?: L-asparaginase

      descriptions from strain specific annotations:

    • L-asparaginase
    • Alpha/beta hydrolase fold-3 domain-containing protein
    • asparaginase/glutaminase
    • asparaginase family protein
    • putative L-asparaginase
  • strand?: +
  • coordinates?: 4258379..4259365
  • synteny block?: BlockID0029890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1519 (ansA)
    N315:
    SA1310 (ansA)
    NCTC8325:
    Newman:
    NWMN_1387 (ansA)
    USA300_FPR3757:
    04-02981:
    SA2981_1435 (ansA)
    08BA02176:
    C248_1519
    11819-97:
    MS7_1432
    71193:
    ST398NM01_1477
    ECT-R 2:
    ECTR2_1330
    ED133:
    SAOV_1485
    ED98:
    SAAV_1465 (ansA)
    HO 5096 0412:
    SAEMRSA15_13380
    JH1:
    SaurJH1_1566
    JH9:
    SaurJH9_1535
    JKD6008:
    SAA6008_01447 (ansA)
    JKD6159:
    SAA6159_01342 (ansA)
    LGA251:
    SARLGA251_13910
    M013:
    M013TW_1425
    MRSA252:
    SAR1487
    MSHR1132:
    SAMSHR1132_13170
    MSSA476:
    SAS1419
    Mu3:
    SAHV_1467 (ansA)
    Mu50:
    SAV1479 (ansA)
    MW2:
    MW1367 (ansA)
    RF122:
    SAB1341
    ST398:
    SAPIG1477
    T0131:
    SAT0131_01567
    TCH60:
    HMPREF0772_11727 (ansB)
    TW20:
    SATW20_14760
    USA300_TCH1516:
    USA300HOU_1416 (aspG)
    VC40:
    SAVC_06640

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKHLLVIHTGGTISMSQDQSNKVVTNDINPISMHQDVINQYAQIDELNPFNVPSPHMTIQ
    N315            MKHLLVIHTGGTISMSQDQSNKVVTNDINPISMHQDVINQYAQIDELNPFNVPSPHMTIQ
    NCTC8325        MKHLLVIHTGGTISMSQDQSNKVVTNDINPISMHQDVINQYAQIDELNPFNVPSPHMTIQ
    Newman          MKHLLVIHTGGTISMSQDQSNKVVTNDINPISMHQDVINQYAQIDELNPFNVPSPHMTIQ
    USA300_FPR3757  MKHLLVIHTGGTISMSQDQSNKVVTNDINPISMHQDVINQYAQIDELNPFNVPSPHMTIQ
                    ************************************************************

    COL             HVKQLKDIILEAVTNKYYDGFVITHGTDTLEETAFLLDLILGIEQPVVITGAMRSSNEIG
    N315            HVKQLKDIILEAVTNKYYDGFVITHGTDTLEETAFLLDLILGIEQPVVITGAMRSSNEIG
    NCTC8325        HVKQLKDIILEAVTNKYYDGFVITHGTDTLEETAFLLDLILGIEQPVVITGAMRSSNEIG
    Newman          HVKQLKDIILEAVTNKYYDGFVITHGTDTLEETAFLLDLILGIEQPVVITGAMRSSNEIG
    USA300_FPR3757  HVKQLKDIILEAVTNKYYDGFVITHGTDTLEETAFLLDLILGIEQPVVITGAMRSSNEIG
                    ************************************************************

    COL             SDGLYNYISAIRVASDEKARHKGVMVVFNDEIHTARNVTKTHTSNTNTFQSPNHGPLGVL
    N315            SDGLYNYISAIRVASDEKARHKGVMVVFNDEIHTARNVTKTHTSNTNTFQSPNHGPLGVL
    NCTC8325        SDGLYNYISAIRVASDEKARHKGVMVVFNDEIHTARNVTKTHTSNTNTFQSPNHGPLGVL
    Newman          SDGLYNYISAIRVASDEKARHKGVMVVFNDEIHTARNVTKTHTSNTNTFQSPNHGPLGVL
    USA300_FPR3757  SDGLYNYISAIRVASDEKARHKGVMVVFNDEIHTARNVTKTHTSNTNTFQSPNHGPLGVL
                    ************************************************************

    COL             TKDRVQFHHMPYRQQALENVNDKLNVPLVKAYMGMPGDIFSFYSREGIDGMVIEALGQGN
    N315            TKDRVQFHHMPYRQQALENVNDKLNVPLVKAYMGMPGDIFSFYSREGIDGMVIEALGQGN
    NCTC8325        TKDRVQFHHMPYRQQALENVNDKLNVPLVKAYMGMPGDIFSFYSREGIDGMVIEALGQGN
    Newman          TKDRVQFHHMPYRQQALENVNDKLNVPLVKAYMGMPGDIFSFYSREGIDGMVIEALGQGN
    USA300_FPR3757  TKDRVQFHHMPYRQQALENVNDKLNVPLVKAYMGMPGDIFSFYSREGIDGMVIEALGQGN
                    ************************************************************

    COL             IPPSALEGIQQLVSLNIPIVLVSRSFNGIVSPTYAYDGGGYQLAQQGFIFSNGLNGPKAR
    N315            IPPSALEGIQQLVSLNIPIVLVSRSFNGIVSPTYAYDGGGYQLAQQGFIFSNGSNGPKAR
    NCTC8325        IPPSALEGIQQLVSLNIPIVLVSRSFNGIVSPTYAYDGGGYQLAQQGFIFSNGLNGPKAR
    Newman          IPPSALEGIQQLVSLNIPIVLVSRSFNGIVSPTYAYDGGGYQLAQQGFIFSNGLNGPKAR
    USA300_FPR3757  IPPSALEGIQQLVSLNIPIVLVSRSFNGIVSPTYAYDGGGYQLAQQGFIFSNGLNGPKAR
                    ***************************************************** ******

    COL             LKLLVALSNNLDKAEIKSYFEL
    N315            LKLLVALSNNLDKAEIKSYFEL
    NCTC8325        LKLLVALSNNLDKAEIKSYFEL
    Newman          LKLLVALSNNLDKAEIKSYFEL
    USA300_FPR3757  LKLLVALSNNLDKAEIKSYFEL
                    **********************