From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004042000
  • symbol?: malA
  • description?: alpha-D-1,4-glucosidase

      descriptions from strain specific annotations:

    • alpha-D-1,4-glucosidase
    • oligo-1,6-glucosidase
    • alpha amylase
    • maltodextrose utilization protein MalA
    • oligo-1,6-glucosidase (Oligosaccharide alpha-1,6-glucosidase) (Sucrase-isomaltase) (Isomaltase) (Dextrin 6-alpha-D-glucanohydrolase)
    • exo-alpha-1,4-glucosidase
    • alpha-glucosidase
  • strand?: -
  • coordinates?: 4329307..4330446
  • synteny block?: BlockID0030790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1551 (malA)
    N315:
    SA1338 (malA)
    NCTC8325:
    Newman:
    NWMN_1414 (malA)
    USA300_FPR3757:
    04-02981:
    SA2981_1464 (malA)
    08BA02176:
    C248_1549 (malA)
    11819-97:
    MS7_1525 (malA)
    71193:
    ST398NM01_1573
    ECT-R 2:
    ECTR2_1358
    ED133:
    SAOV_1509 (malA)
    ED98:
    SAAV_1498 (malA)
    HO 5096 0412:
    SAEMRSA15_14290 (malA)
    JH1:
    SaurJH1_1595
    JH9:
    SaurJH9_1564
    JKD6008:
    SAA6008_01477 (malA)
    JKD6159:
    SAA6159_01436 (malA)
    LGA251:
    SARLGA251_14150 (malA)
    M013:
    M013TW_1522
    MRSA252:
    SAR1584 (malA)
    MSHR1132:
    SAMSHR1132_13460
    MSSA476:
    SAS1447
    Mu3:
    SAHV_1495 (malA)
    Mu50:
    SAV1507 (malA)
    MW2:
    MW1461 (malA)
    RF122:
    SAB1368c (malA)
    ST398:
    SAPIG1573
    T0131:
    SAT0131_01601
    TCH60:
    HMPREF0772_11634 (malA)
    TW20:
    SATW20_15050 (malA)
    USA300_TCH1516:
    USA300HOU_1509 (malA)
    VC40:
    SAVC_06785

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKQWWKEAVAYQVYPRSFNDSNHDGIGDLPGMIDKLDYLKDFGIDVIWLSPMFKSPNDD
    N315            MNKQWWKEAVAYQVYPRSFNDSNHDGIGDLPGMIDKLDYLKDLGIDVIWLSPMFKSPNDD
    NCTC8325        MNKQWWKEAVAYQVYPRSFNDSNHDGIGDLPGMIDKLDYLKDFGIDVIWLSPMFKSPNDD
    Newman          MNKQWWKEAVAYQVYPRSFNDSNHDGIGDLPGMIDKLDYLKDFGIDVIWLSPMFKSPNDD
    USA300_FPR3757  MNKQWWKEAVAYQVYPRSFNDSNHDGIGDLPGMIDKLDYLKDFGIDVIWLSPMFKSPNDD
                    ******************************************:*****************

    COL             NGYDISDYQEIMDEFGTMEDFDRLLKGVHDRGMKLILDLVVNHTSDEHPWFIESKSSKDN
    N315            NGYDISDYQEIMDEFGTMEDFDCLLKGIHDRGMKLILDLVVNHTSDEHPWFIESKSSKDN
    NCTC8325        NGYDISDYQEIMDEFGTMEDFDRLLKGVHDRGMKLILDLVVNHTSDEHPWFIESKSSKDN
    Newman          NGYDISDYQEIMDEFGTMEDFDRLLKGVHDRGMKLILDLVVNHTSDEHPWFIESKSSKDN
    USA300_FPR3757  NGYDISDYQEIMDEFGTMEDFDRLLKGVHDRGMKLILDLVVNHTSDEHPWFIESKSSKDN
                    ********************** ****:********************************

    COL             PKRDWYIWQDPKPDGSEPNNWESIFNGSTWEYDANTEQYYFHLFSKKQPDLNWGNPEVRD
    N315            PKRDWYIWQDPKQDGSEPNNWESIFNGSTWEYDANTEQYYFHLFSKKQPDLNWGNPEVRD
    NCTC8325        PKRDWYIWQDPKPDGSEPNNWESIFNGSTWEYDANTEQYYFHLFSKKQPDLNWGNPEVRD
    Newman          PKRDWYIWQDPKPDGSEPNNWESIFNGSTWEYDANTEQYYFHLFSKKQPDLNWGNPEVRD
    USA300_FPR3757  PKRDWYIWQDPKPDGSEPNNWESIFNGSTWEYDANTEQYYFHLFSKKQPDLNWGNPEVRD
                    ************ ***********************************************

    COL             AVFEMMNWWFDKGIDGFRVDAITHIKKTFEAGDLPVPEGKTYAPAFDVDMNQPGIQTWLQ
    N315            AVFEMMNWWFDKGIDGFRVDAITHIKKTFEAGDLPVPEGKTYAPAFDVDMNQPGIQTWLQ
    NCTC8325        AVFEMMNWWFDKGIDGFRVDAITHIKKTFEAGDLPVPEGKTYAPAFDVDMNQPGIQTWLQ
    Newman          AVFEMMNWWFDKGIDGFRVDAITHIKKTFEAGDLPVPEGKTYAPAFDVDMNQPGIQTWLQ
    USA300_FPR3757  AVFEMMNWWFDKGIDGFRVDAITHIKKTFEAGDLPVPEGKTYAPAFDVDMNQPGIQTWLQ
                    ************************************************************

    COL             EMKDRSLSKYDIMTVGEANGVSPDDADDWVGEENGKFNMIFQFEHLGLWNSGDSHFDVNS
    N315            EMKDRSLSKYDIMTVGEANGVSPDDADDWVGEENGKFNMIFQFEHLGLWNSGDSHFDVNS
    NCTC8325        EMKDRSLSKYDIMTVGEANGVSPDDADDWVGEENGKFNMIFQFEHLGLWNSGDSHFDVNS
    Newman          EMKDRSLSKYDIMTVGEANGVSPDDADDWVGEENGKFNMIFQFEHLGLWNSGDSHFDVNS
    USA300_FPR3757  EMKDRSLSKYDIMTVGEANGVSPDDADDWVGEENGKFNMIFQFEHLGLWNSGDSHFDVNS
                    ************************************************************

    COL             YKSVLNRWQKQLENKGWNALFIENHDQPRRVSTWGDDDKYWYESATSHAAVYFLQQGTPF
    N315            YKSVLNRWQKQLENKGWNALFIENHDQPRRVSTWGDDDKYWYESATSHAAVYFLQQGTPF
    NCTC8325        YKSVLNRWQKQLENKGWNALFIENHDQPRRVSTWGDDDKYWYESATSHAAVYFLQQGTPF
    Newman          YKSVLNRWQKQLENKGWNALFIENHDQPRRVSTWGDDDKYWYESATSHAAVYFLQQGTPF
    USA300_FPR3757  YKSVLNRWQKQLENKGWNALFIENHDQPRRVSTWGDDDKYWYESATSHAAVYFLQQGTPF
                    ************************************************************

    COL             IYQGQEIGMTNYPFESIETFNDVAVKNDYQIVKAQGGDVDALLAKYKDENRDNSRTPMQW
    N315            IYQGQEIGMTNYPFESIETFNDVAVKNDYQIVKAQGGDVDALLAKYKDENRDNSRTPMQW
    NCTC8325        IYQGQEIGMTNYPFESIETFNDVAVKNDYQIVKAQGGDVDALLAKYKDENRDNSRTPMQW
    Newman          IYQGQEIGMTNYPFESIETFNDVAVKNDYQIVKAQGGDVDALLAKYKDENRDNSRTPMQW
    USA300_FPR3757  IYQGQEIGMTNYPFESIETFNDVAVKNDYQIVKAQGGDVDALLAKYKDENRDNSRTPMQW
                    ************************************************************

    COL             DDTLNGGFTNGEPWFPVNPNYKTINVAQQLEDEHSVLQFYKDLIQLRKSNDVYVYGQFDL
    N315            DDTLNGGFTNGEPWFPVNLNYKTINVAQQLEDEHSVLQFYKDLIQLRKSNDVYVYGQFDL
    NCTC8325        DDTLNGGFTNGEPWFPVNPNYKTINVAQQLEDEHSVLQFYKDLIQLRKSNDVYVYGQFDL
    Newman          DDTLNGGFTNGEPWFPVNPNYKTINVAQQLEDEHSVLQFYKDLIQLRKSNDVYVYGQFDL
    USA300_FPR3757  DDTLNGGFTNGEPWFPVNPNYKTINVAQQLEDEHSVLQFYKDLIQLRKSNDVYVYGQFDL
                    ****************** *****************************************

    COL             VDAENSQVFAYTRTLNEKQVLIVGNLTNHEAELTVPFDLSHGEVKLFNYDAKVNLKQLRP
    N315            VDAENSQVFAYTRTLNEKQVLIVGNLTNHEAELTVPFDLSHGEVKLFNYDAKVNLKQLRP
    NCTC8325        VDAENSQVFAYTRTLNEKQVLIVGNLTNHEAELTVPFDLSHGEVKLFNYDAKVNLKQLRP
    Newman          VDAENSQVFAYTRTLNEKQVLIVGNLTNHEAELTVPFDLSHGEVKLFNYDAKVNLKQLRP
    USA300_FPR3757  VDAENSQVFAYTRTLNEKQVLIVGNLTNHEAELTVPFDLSHGEVKLFNYDAKVNLKQLRP
                    ************************************************************

    COL             YEACVIELN
    N315            YEACVIELN
    NCTC8325        YEACVIELN
    Newman          YEACVIELN
    USA300_FPR3757  YEACVIELN
                    *********