From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004071000
  • symbol?: bfmBAB
  • description?: branched-chain alpha-keto acid dehydrogenase E1

      descriptions from strain specific annotations:

    • branched-chain alpha-keto acid dehydrogenase E1
    • 2-oxoisovalerate dehydrogenase subunit beta
    • 2-oxoisovalerate dehydrogenase, E1 component, beta subunit
    • Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit
    • transketolase, central region
    • 2-oxoisovalerate dehydrogenase, E1 component subunit beta
    • 2-oxoisovalerate dehydrogenase (acylating) beta subunit
    • 2-oxoisovalerate dehydrogenase subunit beta (branched-chain alpha-keto acid dehydrogenase e1 component beta chain) (bckdhe1-beta)
    • acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta
    • 2-oxoisovalerate dehydrogenase beta subunit
  • strand?: -
  • coordinates?: 4352458..4353441
  • synteny block?: BlockID0031030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1347 (bfmBAB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1475 (bfmBAB)
    08BA02176:
    C248_1559 (bfmBAB)
    11819-97:
    MS7_1534 (bfmBAB)
    71193:
    ST398NM01_1582
    ECT-R 2:
    ECTR2_1368
    ED133:
    SAOV_1517
    ED98:
    SAAV_1509
    HO 5096 0412:
    SAEMRSA15_14370 (bfmBAB)
    JH1:
    SaurJH1_1608
    JH9:
    SaurJH9_1575
    JKD6008:
    SAA6008_01486 (bfmBAB)
    JKD6159:
    SAA6159_01452 (bfmBAB)
    LGA251:
    SARLGA251_14230 (bfmBAB)
    M013:
    M013TW_1532
    MRSA252:
    SAR1594 (bfmBAB)
    MSHR1132:
    SAMSHR1132_13570
    MSSA476:
    SAS1455
    Mu3:
    SAHV_1504 (bfmBAB)
    Mu50:
    SAV1516 (bfmBAB)
    MW2:
    MW1469 (bfmBAB)
    RF122:
    SAB1389c
    ST398:
    SAPIG1582
    T0131:
    SAT0131_01610
    TCH60:
    HMPREF0772_11624 (acoB)
    TW20:
    SATW20_15130 (bfmBAB)
    USA300_TCH1516:
    USA300HOU_1518
    VC40:
    SAVC_06830

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKLSYLEAIRQAQDLALQQNKDVFILGEDVGRKGGVFGTTQGLQQKYGEDRVIDTPLAE
    N315            MAKLSYLEAIRQAQDLALQQNKDVFILGEDVGKKGGVFGTTQGLQQQYGEDRVIDTPLAE
    NCTC8325        MAKLSYLEAIRQAQDLALQQNKDVFILGEDVGRKGGVFGTTQGLQQKYGEDRVIDTPLAE
    Newman          MAKLSYLEAIRQAQDLALQQNKDVFILGEDVGRKGGVFGTTQGLQQKYGEDRVIDTPLAE
    USA300_FPR3757  MAKLSYLEAIRQAQDLALQQNKDVFILGEDVGRKGGVFGTTQGLQQKYGEDRVIDTPLAE
                    ********************************:*************:*************

    COL             SNIVGTAIGAAMVGKRPIAEIQFADFILPATNQIISEAAKMRYRSNNDWQCPLTIRAPFG
    N315            SNIVGTAIGAAMVGKRPIAEIQFADFILPATNQIISEAAKMRYRSNNDWQCPLTIRAPFG
    NCTC8325        SNIVGTAIGAAMVGKRPIAEIQFADFILPATNQIISEAAKMRYRSNNDWQCPLTIRAPFG
    Newman          SNIVGTAIGAAMVGKRPIAEIQFADFILPATNQIISEAAKMRYRSNNDWQCPLTIRAPFG
    USA300_FPR3757  SNIVGTAIGAAMVGKRPIAEIQFADFILPATNQIISEAAKMRYRSNNDWQCPLTIRAPFG
                    ************************************************************

    COL             GGVHGGLYHSQSIESIFASSPGLTIVIPSTPYDAKGLLLSSIESNDPVLYFEHKKAYRFL
    N315            GGVHGGLYHSQSIESIFASSPGLTIVIPSTPYDAKGLLLSSIESNDPVLYFEHKKAYRFL
    NCTC8325        GGVHGGLYHSQSIESIFASSPGLTIVIPSTPYDAKGLLLSSIESNDPVLYFEHKKAYRFL
    Newman          GGVHGGLYHSQSIESIFASSPGLTIVIPSTPYDAKGLLLSSIESNDPVLYFEHKKAYRFL
    USA300_FPR3757  GGVHGGLYHSQSIESIFASSPGLTIVIPSTPYDAKGLLLSSIESNDPVLYFEHKKAYRFL
                    ************************************************************

    COL             KEEVPEEYYTVPLGKADVKREGEDLTVFCYGLMVNYCLQAADILAADGINVEVVDLRTVY
    N315            KEEVPEEYYTVPLGKADVKREGEDLTVFCYGLMVNYCLQAADILAADGINVEVVDLRTVY
    NCTC8325        KEEVPEEYYTVPLGKADVKREGEDLTVFCYGLMVNYCLQAADILAADGINVEVVDLRTVY
    Newman          KEEVPEEYYTVPLGKADVKREGEDLTVFCYGLMVNYCLQAADILAADGINVEVVDLRTVY
    USA300_FPR3757  KEEVPEEYYTVPLGKADVKREGEDLTVFCYGLMVNYCLQAADILAADGINVEVVDLRTVY
                    ************************************************************

    COL             PLDKETIIDRAKHTGKVLLVTEDNLEGSIMSEVSAIIAEHCLFDLDAPIMRLAAPDVPSM
    N315            PLDKETIIDRAKNTGKVLLVTEDNLEGSIMSEVSAIIAEHCLFDLDAPIMRLAAPDVPSM
    NCTC8325        PLDKETIIDRAKHTGKVLLVTEDNLEGSIMSEVSAIIAEHCLFDLDAPIMRLAAPDVPSM
    Newman          PLDKETIIDRAKHTGKVLLVTEDNLEGSIMSEVSAIIAEHCLFDLDAPIMRLAAPDVPSM
    USA300_FPR3757  PLDKETIIDRAKHTGKVLLVTEDNLEGSIMSEVSAIIAEHCLFDLDAPIMRLAAPDVPSM
                    ************:***********************************************

    COL             PFSPVLENEIMMNPEKILNKMRELAEF
    N315            PFSPVLENEIMMNPEKILNKMRELAEF
    NCTC8325        PFSPVLENEIMMNPEKILNKMRELAEF
    Newman          PFSPVLENEIMMNPEKILNKMRELAEF
    USA300_FPR3757  PFSPVLENEIMMNPEKILNKMRELAEF
                    ***************************